KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0907Help
Entry
Rpal_0907         CDS       T00722                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00260  Glycine, serine and threonine metabolism
rpt00750  Vitamin B6 metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01230  Biosynthesis of amino acids
Module
rpt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_0907
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpal_0907
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rpal_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP GAF_2
Motif
Other DBs
NCBI-ProteinID: ACE99464
JGI: Rpal0907
UniProt: B3QF30
Position
964660..966078
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGDAPRLGFCDVMLTGLARDGGLYIPEVWPQLTPDTITSLFGRPYWEVAVEVI
RPFVAGEISDAELGRMASDAYATFRHPAVVPLRQTGSSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRKQRTTIVVATSGDTGGAAVEAFANLNNVDLVVLFPHGRISDVQRMMMTT
SGAPNVHPLAIEGHFDDCQAIVKGLFNHHKFRDQVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRVVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILARTLKTGIYEVRE
VHATTSPSMDIQVSSNFERLLFEASGRDASLIRSLMGSLAQSGRFVLPDAVLAAVREEFD
AGRADEAETESAIRAAWREAGDLIDPHTAVALAVADRDTTDSSVPNIVLSTAHAAKFPDA
VEAACGIRPELPAWLDGLMSKTESIKIMPRDQVAIERHVLAVSRAAKQGAAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctatgtttcgacccggggcgatgccccgcgcctcggcttttgcgacgtgatg
ctgaccgggctcgcccgtgacggcggactatatattcccgaagtctggccgcagctcact
cccgacaccatcaccagcctgttcggccggccgtattgggaggtcgccgtcgaggtgatc
cggccgttcgtggccggcgagatttccgatgccgagctcggccgcatggcgagcgacgcc
tatgccactttccgacacccggcggtggtgccgctgcgccagaccggctcgagccagttc
gtgctcgagctgttccatggcccgacgctggcgttcaaggacgtcgcgatgcagctgctg
tcgcggctgatggatcacgtgctggagaagcgcaagcagcgcaccacgatcgtggtggcg
acttccggcgacaccggcggcgccgcggtcgaagccttcgccaacctgaacaatgtcgac
ctcgtcgtgctgtttccgcacggccggatctccgacgtgcagcggatgatgatgaccacg
tcgggtgcgccgaacgttcacccgctggcgatcgagggccacttcgacgactgccaggcg
atcgtgaaggggctgttcaatcatcataaattccgcgaccaggtggcgctgtccggcgtc
aactcgatcaactgggcgcggatcgtggcgcaggtggtgtattacttcaccagcgccgtg
gcgctcggcgcgccgaaccgcgtggtcgacttcaccgtgccgaccggcaatttcggcgac
atcttcgccggttacgtcgccaagaagatgggcctgccggtgcgccggttgaagatcgcc
gccaacgtcaacgacattctggcgcgtacactgaagaccggcatctacgaagtgcgcgag
gttcacgccaccacctcgccgtcgatggacatccaggtgtcgtcgaatttcgagcgactg
ctgttcgaggcctccggacgcgatgcctcgctgatccggtcgctgatgggctcgctggct
cagtccggccgcttcgtgcttccggatgcggtcctcgccgcggtgcgcgaggagttcgac
gccggccgcgccgacgaggcggaaaccgaatcggcgatccgtgccgcctggcgcgaggcc
ggcgacctgatcgatccgcacaccgcggtggcgctggcagtggccgatcgcgacaccact
gattcgagcgtgccgaacatcgtgctgtcgaccgcccatgcggccaagttcccggacgcg
gtcgaagccgcttgcggtatccggccggagctgccggcctggctcgacgggctgatgagc
aagaccgaatcgatcaagatcatgccgcgcgatcaagtggcgatcgaacgtcacgtgctg
gcggtgagccgcgccgccaagcaaggagccgccggatga

DBGET integrated database retrieval system