KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0956Help
Entry
Rpal_0956         CDS       T00722                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rpt00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1017115..1018059)
Genome map
AA seq 314 aa AA seqDB search
MTLVSTPANPVPEDAVSGFIKTPDGVQLRFARWEPPGHRKGTVCVFTGRTEQIEKYFETV
RDLRDRGFAVAALDWRGQGHSERRLRDYRKGYVRNFADFEVDVETFVREVVLPDCPPPHF
ALAHSMGGAVMLRIARSGKRWFDRMVLSAPMIDLAGNTTALPIRLLLRAMRLAGQGGRYV
PGGNDVLANTEPFVGNKLTSDPVRYARNAAIVAEDPTLGLASPTVAWADTAFRAMHAFKA
TNYPSQIRQPILMIAAGMDGVVSTPAIEEFAYHLRAGSHLVIPGAKHEILQEQDRYRQQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgactcctgccaatccggtgcccgaagacgccgtctccggcttcatc
aagacgcccgatggcgtccagctgcggtttgcgcgatgggagccgccggggcaccgcaaa
ggcaccgtatgcgtcttcaccggacgcaccgaacagatcgagaagtacttcgagacggtg
cgcgatctgcgcgatcgcggctttgcagtcgcggcgctcgactggcgcggccagggccat
tccgagcgccggctgcgcgactatcgcaagggctatgtgcgcaacttcgccgacttcgag
gtcgacgtcgaaaccttcgtgcgtgaagtcgtgctgccggactgcccgccgccgcatttc
gcgctggcgcattcgatgggcggggcggtgatgctgcggatcgcccgctccggcaagcgc
tggttcgaccgcatggtgctgtcggccccgatgatcgaccttgccggcaacaccaccgcg
ctgccgatcaggctgttgctgcgggcgatgcggctggccggccaaggcggccgttacgtt
cccggcggcaacgacgtgctcgccaacaccgagccgttcgtcggaaacaagctgacctcg
gatccggtgcgctacgcccgcaacgccgcgatcgtcgccgaagatccgaccctgggcctc
gcctcgccgaccgtcgcatgggccgacaccgctttccgcgccatgcacgccttcaaggcg
accaactatccgtcgcagatccggcagccgatcctgatgatcgcggccggtatggacggc
gtggtgtcgacgccggcgatcgaagagttcgcttatcatttgcgggccggctcgcatctg
gtgatccccggcgccaagcacgaaatcctccaggagcaggatcgctaccgccagcaattc
tgggcggcgttcgatgctttcgtaccggggacgccgcttttctga

DBGET integrated database retrieval system