KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0956Help
Entry
Rpal_0956         CDS       T00722                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rpal_0956
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rpal_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1017115..1018059)
Genome map
AA seq 314 aa AA seqDB search
MTLVSTPANPVPEDAVSGFIKTPDGVQLRFARWEPPGHRKGTVCVFTGRTEQIEKYFETV
RDLRDRGFAVAALDWRGQGHSERRLRDYRKGYVRNFADFEVDVETFVREVVLPDCPPPHF
ALAHSMGGAVMLRIARSGKRWFDRMVLSAPMIDLAGNTTALPIRLLLRAMRLAGQGGRYV
PGGNDVLANTEPFVGNKLTSDPVRYARNAAIVAEDPTLGLASPTVAWADTAFRAMHAFKA
TNYPSQIRQPILMIAAGMDGVVSTPAIEEFAYHLRAGSHLVIPGAKHEILQEQDRYRQQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgactcctgccaatccggtgcccgaagacgccgtctccggcttcatc
aagacgcccgatggcgtccagctgcggtttgcgcgatgggagccgccggggcaccgcaaa
ggcaccgtatgcgtcttcaccggacgcaccgaacagatcgagaagtacttcgagacggtg
cgcgatctgcgcgatcgcggctttgcagtcgcggcgctcgactggcgcggccagggccat
tccgagcgccggctgcgcgactatcgcaagggctatgtgcgcaacttcgccgacttcgag
gtcgacgtcgaaaccttcgtgcgtgaagtcgtgctgccggactgcccgccgccgcatttc
gcgctggcgcattcgatgggcggggcggtgatgctgcggatcgcccgctccggcaagcgc
tggttcgaccgcatggtgctgtcggccccgatgatcgaccttgccggcaacaccaccgcg
ctgccgatcaggctgttgctgcgggcgatgcggctggccggccaaggcggccgttacgtt
cccggcggcaacgacgtgctcgccaacaccgagccgttcgtcggaaacaagctgacctcg
gatccggtgcgctacgcccgcaacgccgcgatcgtcgccgaagatccgaccctgggcctc
gcctcgccgaccgtcgcatgggccgacaccgctttccgcgccatgcacgccttcaaggcg
accaactatccgtcgcagatccggcagccgatcctgatgatcgcggccggtatggacggc
gtggtgtcgacgccggcgatcgaagagttcgcttatcatttgcgggccggctcgcatctg
gtgatccccggcgccaagcacgaaatcctccaggagcaggatcgctaccgccagcaattc
tgggcggcgttcgatgctttcgtaccggggacgccgcttttctga

DBGET integrated database retrieval system