KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1231Help
Entry
Rpal_1231         CDS       T00722                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rpt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1303353..1304252
Genome map
AA seq 299 aa AA seqDB search
MTDGSAMTLRDEARAKVNLTLRVVGRRPDGYHELESVVAFADCADHLTLQPGAALSLTTI
GPGAQDCGDSADNLVLKAARLLGERVPDLTTGAFTLDKHLPVAAGIGGGSADAAAALRLL
ARANDLAVDDPRLVEAARLTGADVPVCLPSKPCVMTGVGEKLSPLPLPRIPAVMVNPRVP
VATKDVFTALGLKPGSLAVGATDVLAAPAWPEAGAALANWVVALEAGTNDLEPPALKVEP
VVGTVLEALRATAGVQLARMSGSGATCFALYADDASARAAADALCAAHPGWWVHAGSLS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacggctctgcgatgacactgcgcgacgaggcgcgcgccaaggtgaacctgacg
ctgcgtgtggttggccgtcgccccgacggctaccacgagctggaaagcgtggtggcgttt
gccgattgcgccgatcacctgaccctgcagcccggcgcagcgctgagcctgaccacgatc
ggccccggcgcgcaggattgcggcgacagcgccgacaatctggtgctgaaggctgcgcgg
ctgctcggtgagcgggtgccggacctgacaaccggcgccttcaccctcgacaagcatctg
ccggtggcggccggcatcggcggcggctcggccgacgctgccgcagcgctgcggttgctt
gcccgcgccaatgatctcgccgttgatgatccgcgcctggttgaagccgcccggctgacc
ggcgccgatgttccggtttgcctgccgtcgaagccgtgtgtgatgaccggcgtcggcgag
aagctgtcgccgctgccgctgccgcggatcccggccgtgatggtcaatccgcgggtaccg
gtggccaccaaggacgtgttcaccgcgctcggtctgaagcccggctcgcttgcagtcggc
gccactgacgtcctcgctgcaccggcttggccggaagccggcgcggcgctcgccaattgg
gtcgtggcgcttgaggccggcactaacgatctcgagccgccggccctcaaggtcgagccg
gtggtcggcaccgtgctggaggcgctccgcgcgaccgccggtgtccagctcgcccggatg
tccggatcgggcgcgacctgctttgcgctgtatgccgatgatgcttcagcccgcgctgct
gcggacgcgctctgcgccgcgcatcccggctggtgggtccacgccggcagcctgagctga

DBGET integrated database retrieval system