KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1693Help
Entry
Rpal_1693         CDS       T00722                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00860  Porphyrin and chlorophyll metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpal_1693
Enzymes [BR:rpt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rpal_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_29 AAA DUF815 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACF00221
JGI: Rpal1693
UniProt: B3Q6E4
Position
1815688..1816710
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQEEMKLALLIAAVDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKTVV
GCRYNCDPDQPDRYCEECKEKVKHGKVKTAQVPVPVVDLPLGATEDRVVGALDLERALAK
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDTLPERIEVVRRRDAFENDPAAFVADWSKEEA
KLRRKISQAKERLPEVTVSDAALERAAKLCMTLGTDGLRGELTLMRAARALAALEHDKTV
TDEHLKRIAPSALRHRLRRNPLDDAGSSVRVDRALAEIFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgtttccgttctccgcgatcgtcggccaggaagagatgaagctggctctg
ctgatcgcagctgtcgatcagaaggtcggcggcgtgctggcgttcggcgatcgcggcgcc
ggcaagtcgaccgccgtgcgcgctctcgcagcgctgctgccaaagatgaagaccgtggtc
ggttgccgctacaattgcgatcccgatcagcccgatcgttactgcgaagagtgcaaggaa
aaggtcaaacacggcaaggtcaagaccgcgcaggtgccggtgccggtggtcgatctgccg
ctcggcgcgaccgaagaccgcgtcgtcggcgcgctcgacctggagcgtgcgctcgccaag
ggcgagaaggcgtttgagcctggcctgctggcgcgggcacatcgcggcttcctgtacatc
gacgaagccaacctgctggaagaccatctggtcgacctgctgctcgacgtcgccgcctcc
ggcgagaacgtggtcgagcgtgaaggcctcagcattcgtcacccggcgcggttcgtgctg
gtcggcaccggcaaccccgaagagggcgaactgcgtccgcagttgcttgaccgcttcggc
atgtcggtggaagtgaagacgccggacacgctgccggagcgcatcgaagtggtgcgccgc
cgtgatgcgttcgagaacgatcctgccgccttcgtggccgattggtcaaaggaagaggcc
aagctgcgccgcaagatttcgcaggccaaggaacggctgcccgaagtcaccgtgagcgac
gcggcgctggagcgtgccgccaagctgtgtatgacgctcggcaccgacggcctgcgcggc
gaactgaccttgatgcgcgccgcgcgtgcgctcgctgcgctcgagcacgacaagaccgtg
accgatgaacacctgaagcggatcgcgccctctgccttgcggcaccggttgcgccgcaat
ccgctcgacgatgccggctctagcgtgcgtgtcgaccgcgcgctcgccgaaatcttcgga
tga

DBGET integrated database retrieval system