KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1732Help
Entry
Rpal_1732         CDS       T00722                                 

Gene name
bchH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpal_1732 (bchH)
Enzymes [BR:rpt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rpal_1732 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1856382..1860128
Genome map
AA seq 1248 aa AA seqDB search
MPKRTSPADKTPVRVVIVTLDSHLSGAAARARNVLRKDYPGIELTVHSADEWGSDGHALQ
RCLADIATGDIIIATMLFMDDHVRAVMPALQARRTECDAMVCCMSASEVVKLTHIGKFDM
SAEALGMINWLKKLRGKKHEGSAGKGEMKMLRQLPKLLRFVPGTAQDMRAYFLTLQYWLA
GCDQNIANMVRLLIDRYASGPRKGLRGVAKVEPPLEYPDIGVYHPKMKGRIAESVDKLPT
GPSEAKGTVGVLLLRSYLLAGNAGHYDGMLETFEAKGLRVIPVFASGLDQRPAIEQFFIK
NGRSTVDAVVSLTGFSLVGGPAYNDSKAAEDILAALDVPYLSAHPVEFQTLEQWATSDRG
LMPVESTIMVAIPELDGCSNPMVYGGRSDGGDVACPGCEKFCKFERNESGGDMHVCSERA
EMLASRTAKLVALRRSERKDRKVAAVLFNFPPNAGNTGTAAFLGVFESLFNTLKAMKAEG
YTVEVPESVDSLREAIINGNAARFGANANVHARVMAGDHVKNERYLREIEAQWGPAPGKQ
QSDGSSIFILGERFGNVFVGVQPAFGYEGDPMRLLFEKGFAPTHAFSAFYRWIKQDFGAH
AVLHFGTHGALEFMPGKQTGLSGTCWPDRMIGDLPNMYLYASNNPSEGAIAKRRSAATLV
SYLTPPVAHAGLYRGLLELKSSLERWRGLTPEEETERANLATLVQAQAAGLDLAPAEPAW
TAEEAGATIAKLADSVLEMEYALIPHGLHVVGNVPSEEERVETLEAVADAMHGKRPDKSL
LEALVRGGHPEHLSGNGPEAQANLDMLKELAGIDKLLAEDHELAAILRALDGKFIRPAPG
GDLLRTPAVLPTGRNLHGFDPFRIPSAYALQDGAKQAQRLIDKHIAEGNPLPETVAIVLW
GTDNLKNEGAPIGQALALMGARPRFDGYGRLAGADLIPLEELGRPRIDVIITMSGIFRDL
LPLQIKLLAEAAFMAASAEEPAEQNFIRKHSLAYQAEHKCDMETASLRVFGNADGAYGSN
VNHLVENSRWEDEDELAETYTKRKSFAYGLKGQPVQHAELLKSALADVDLAYQNLDSVEL
GVTTVDHYFDTLGGISRAVRKAKGGQAAPVYIGDQTRGAGTVRTLSEQVALETRTRMLNP
KWYEGMLKHGYEGVRQIEEHVTNTMGWSATTGEVAPWVYKQLTETFVLDPEMRARLAALN
PVASAKVANRLIEAHERNYWSPDPEMLETLRKAGEELEDRLEGVGVAA
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcgcacttcgcccgctgacaagaccccggttcgggtcgtcatcgtcacgctg
gacagccatttgtccggtgccgccgcacgtgctcgcaacgtgttgcggaaggattatccc
ggaatcgagctgacggtgcactccgccgacgagtgggggagcgacggacacgcgctgcag
cgctgcctcgccgacatcgccacaggcgacatcatcatcgccaccatgctgttcatggac
gatcacgtccgggcggtaatgccggcgctgcaggcgcggcgcaccgaatgcgacgcgatg
gtgtgctgcatgtcggcctccgaggtggtgaagctcacccacatcggcaagttcgacatg
agcgccgaagcgctcggcatgatcaattggctgaagaagctgcgcggcaagaagcacgaa
ggctcggccggcaagggcgagatgaagatgctgcggcagctgccgaagctgctccgcttc
gtgcccggcaccgcgcaggacatgcgcgcctacttcctgacgctgcagtactggctggcc
ggttgcgaccagaacatcgccaacatggtacggctgctgatcgaccgctacgcgagcggt
ccgcgcaagggtctgcgcggcgtcgccaaggtcgagccgccgctcgaatatcccgatatc
ggcgtgtaccacccgaagatgaagggccggatcgcggagtcagtcgacaagctgccgacg
ggcccgagcgaggccaagggcacggtcggcgtactgctgctgcgctcgtatctgctcgcc
ggcaatgccgggcattatgacggcatgctggagacgttcgaggccaagggtctgcgcgtg
attccggtgttcgcctcgggcctcgatcagcgaccggcgatcgagcagttcttcatcaag
aacggccgttccacggtcgatgcggtggtgtcgctcaccggcttctcgctggtcggcggt
cccgcctacaacgactccaaggcggccgaagacatcctcgccgcgctcgacgtgccgtat
ctgtcggcgcatccggtcgagttccagacgctggagcagtgggcgacgtccgatcgcggc
ctgatgccggtggaaagcaccatcatggtggcgatccccgagctcgacggctgctccaac
ccgatggtctatggcggccgctccgacggcggtgacgtcgcctgcccgggctgcgagaag
ttctgcaagttcgagcgcaacgaaagcggcggcgacatgcatgtctgcagcgagcgcgcc
gaaatgctggcgtcgcgcaccgccaagctggtggcgctgcgccggagcgaacgcaaggac
cgcaaggtcgctgcggtgctgttcaacttcccgccgaatgccggcaacaccggcaccgcg
gcgttcctcggcgtgttcgagtcgctgttcaacacgctgaaggcgatgaaggccgaaggc
tacaccgtcgaggttcccgaaagcgtcgatagcttgcgcgaggcgatcatcaacggcaat
gcggcacggttcggcgccaatgccaacgtccatgcccgcgtgatggccggcgatcacgtc
aagaacgaacgctatctgcgggagatcgaagcgcagtggggtccggcgcccggcaagcag
cagagcgacggttcgtcgatcttcattctcggcgagcgcttcggcaacgtgttcgtcggc
gtgcagccggcgttcggttacgaaggcgacccgatgcggctgctgttcgagaaggggttt
gcgccgacgcacgccttctcggcgttctatcgctggatcaagcaggatttcggcgcccac
gcggtgctgcatttcggcacccacggcgcgctggaattcatgcccggcaagcagaccggc
ctgtccggcacctgctggcccgaccgcatgatcggcgatctgccgaacatgtatctgtac
gcctccaacaacccgtccgaaggtgcgatcgccaagcggcgatcggcggcgacgctggtc
agctacctcacgccgccggtcgcgcatgccggcctgtatcgcgggctgctcgagctgaag
tcttcgctggagcgctggcgcggcctgacgccggaggaagagaccgagcgcgcaaatctc
gcgacgctggtgcaggcgcaggccgccggcctcgacctcgccccggccgaaccggcctgg
accgccgaagaggcgggggcgaccatcgccaagctcgccgactccgtgctcgagatggaa
tacgcgcttatcccgcacggcctccatgtggtcggcaacgtgccgtccgaagaggagcgg
gtcgagacgctggaagccgttgcggatgcgatgcacggcaagcggccggacaagtccttg
ctcgaagcgctggtgcgcggcggtcatcccgagcatctgtccgggaatggtcccgaggct
caggccaatctcgacatgctcaaggagctggccgggatcgacaagctgctcgccgaggat
cacgaactcgccgcgatcctgcgcgcgctcgacggcaagttcatccgtccggcgccgggc
ggcgacctgctgcgcacgcccgcggtgctgccgaccggccgcaacctgcacggcttcgat
ccgttccggattccgtcggcctacgcgctgcaggacggcgccaagcaggcgcagcggctg
atcgacaagcacatcgccgagggcaatccgctgcccgagacggtcgcgatcgtgctgtgg
ggcaccgacaacctcaagaacgaaggcgcgccgatcggccaagcgctggcgctgatgggc
gcccggccgcggttcgacggctacggccgtctcgccggcgccgatctgatcccgctcgaa
gagctggggcggccgcgcatcgacgtgatcatcaccatgtcgggcatcttccgcgacctg
ctgccgctgcagatcaagctgctcgccgaagccgccttcatggcggcgagcgccgaggag
ccggccgagcagaacttcatccgcaagcattcgctggcctatcaggccgagcacaaatgc
gacatggagaccgcgtcgctgcgggtgttcggcaatgccgacggtgcctacggctccaac
gtcaaccatctggtcgagaacagccgctgggaagacgaggacgagctcgccgagacctat
accaagcgcaagagcttcgcttacggtctcaagggccagccggtgcagcacgccgaactg
ctcaagagcgcgctcgccgacgtcgatctcgcttatcagaacctcgactcggtcgagctc
ggcgtcaccaccgtcgatcactacttcgacacgctcggcggcatcagccgcgcggtgcgc
aaggcgaagggcggccaggctgcgccggtgtatatcggcgatcagacccgcggcgccggc
accgtccggacgctgtcggagcaggtcgcactcgagactcgcactcggatgctgaatccg
aagtggtacgagggcatgctcaagcatggctacgaaggcgtgcgccagatcgaagagcac
gtcacaaatactatgggctggtcggcaaccacgggtgaagtcgcgccgtgggtgtacaag
cagctcaccgagaccttcgtgctcgaccctgaaatgcgggcacgcctcgccgcgctcaat
ccggtggcttcggcgaaggtcgccaaccgcctgatcgaagcgcacgaacgcaactactgg
tctccggacccggaaatgctcgagaccctgcgcaaggcaggcgaagagctcgaggatcgc
ctggaaggcgtgggagtggccgcatga

DBGET integrated database retrieval system