KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1782Help
Entry
Rpal_1782         CDS       T00722                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpal_1782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_1782
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpal_1782
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpal_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1915331..1916695
Genome map
AA seq 454 aa AA seqDB search
MSDQIKYVLDEENIPKSWYNLNADFPTPMPPVLHPGTHQPVGPSDLEPLFPMELILQEVA
TERYIEIPEPVRDVFRMWRPAPLIRARRLEQALGTPAKIYFKYEGVSPAGSHKPNTAVPQ
AWYNKQAGIKKLSTETGAGQWGSSLAFAGSLFGLDVLVFQVRVSYDQKPYRRALMETYGA
RCIASPSNETDSGRAILEKNPNSPGSLGIAISEAVEVAAKNPDIKYALGSVLNHVMLHQT
IIGEEAIKQFELAGDDPDVVIGCAGGGSNFAGLAFPFLGLQLRGGRKRRIIAVEPAACPT
LTRGTYAYDFGDTAHLTPLVKMHTLGSTFMPPGFHAGGLRYHGMSGMVSHAYELGLIEAR
AYKQVGCFEAGVQFARTEGIVPAPESTHAVRCAIDEALRCKEEGKSETILFNLSGHGHFD
MQAYINYFEGKLVDQDYDEADLATALAGLPAVAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagatcaagtatgtgctggacgaggagaacatcccgaagtcctggtacaat
ctcaacgccgacttcccgacgccgatgccgccggtcctgcatccgggcacgcatcagccg
gtcggcccgagcgatctggagccgctgtttccgatggagctgatcctccaggaggtcgcg
accgagcgctacatcgagattcccgagccggtccgtgacgtgttccggatgtggcgcccg
gcgccgctgatccgtgcgcgccgcctcgagcaggcgctcggcacgccggccaagatctac
ttcaagtacgaaggcgtttcgccggcaggttcgcacaagccgaacaccgccgtgccgcag
gcctggtacaacaagcaggccggcatcaagaagctgtcgaccgagaccggcgccgggcag
tggggctcgtcgctggcgttcgccggctcgctgttcgggctcgacgtcctcgtcttccag
gtccgcgtgtcgtacgaccagaagccgtatcgccgcgcgctgatggagacctacggcgcc
cgctgcatcgcgtcgccgtcgaacgagaccgattccggccgcgccattctggagaaaaat
ccgaacagccccggctcgctcggcatcgcgatctccgaagcggtggaagtcgccgccaag
aacccggacatcaagtacgcgctgggttcggtgctcaaccacgtgatgctgcaccagacc
atcatcggcgaagaagcgatcaagcagttcgaactggcgggcgatgatccggacgtcgtg
atcggctgcgccggcggcggttcgaacttcgccggtctggccttcccgttcctcggcctg
cagctccgcggcggccgcaagcggcgcatcatcgcggtcgaaccggcggcgtgcccgacc
ctgacccgcggcacctatgcctacgacttcggcgacaccgcgcatctcaccccgctggtg
aagatgcatacgctcggctcaaccttcatgccgccgggcttccacgccggcggtctgcgc
taccacggcatgagcgggatggtgtcgcacgcctacgaactcggcctgatcgaagcccgc
gcctacaagcaggtcggctgcttcgaagccggcgtgcagttcgcccgcaccgaaggcatc
gtgccggcgccggagtccacccacgcggtccgctgcgccatcgacgaggcgctgcgctgc
aaggaggagggcaagtcggaaacgatcctgttcaacctctccggccacggccacttcgac
atgcaggcctacatcaactacttcgaaggcaagctggtcgatcaggactacgacgaagcc
gacctcgccactgcgctggccggcctgccggcggtggcggcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system