KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1782Help
Entry
Rpal_1782         CDS       T00722                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00260  Glycine, serine and threonine metabolism
rpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01130  Biosynthesis of antibiotics
rpt01230  Biosynthesis of amino acids
Module
rpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpal_1782
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpal_1782
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpal_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACF00310
JGI: Rpal1782
UniProt: B3Q7H6
Position
1915331..1916695
Genome map
AA seq 454 aa AA seqDB search
MSDQIKYVLDEENIPKSWYNLNADFPTPMPPVLHPGTHQPVGPSDLEPLFPMELILQEVA
TERYIEIPEPVRDVFRMWRPAPLIRARRLEQALGTPAKIYFKYEGVSPAGSHKPNTAVPQ
AWYNKQAGIKKLSTETGAGQWGSSLAFAGSLFGLDVLVFQVRVSYDQKPYRRALMETYGA
RCIASPSNETDSGRAILEKNPNSPGSLGIAISEAVEVAAKNPDIKYALGSVLNHVMLHQT
IIGEEAIKQFELAGDDPDVVIGCAGGGSNFAGLAFPFLGLQLRGGRKRRIIAVEPAACPT
LTRGTYAYDFGDTAHLTPLVKMHTLGSTFMPPGFHAGGLRYHGMSGMVSHAYELGLIEAR
AYKQVGCFEAGVQFARTEGIVPAPESTHAVRCAIDEALRCKEEGKSETILFNLSGHGHFD
MQAYINYFEGKLVDQDYDEADLATALAGLPAVAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagatcaagtatgtgctggacgaggagaacatcccgaagtcctggtacaat
ctcaacgccgacttcccgacgccgatgccgccggtcctgcatccgggcacgcatcagccg
gtcggcccgagcgatctggagccgctgtttccgatggagctgatcctccaggaggtcgcg
accgagcgctacatcgagattcccgagccggtccgtgacgtgttccggatgtggcgcccg
gcgccgctgatccgtgcgcgccgcctcgagcaggcgctcggcacgccggccaagatctac
ttcaagtacgaaggcgtttcgccggcaggttcgcacaagccgaacaccgccgtgccgcag
gcctggtacaacaagcaggccggcatcaagaagctgtcgaccgagaccggcgccgggcag
tggggctcgtcgctggcgttcgccggctcgctgttcgggctcgacgtcctcgtcttccag
gtccgcgtgtcgtacgaccagaagccgtatcgccgcgcgctgatggagacctacggcgcc
cgctgcatcgcgtcgccgtcgaacgagaccgattccggccgcgccattctggagaaaaat
ccgaacagccccggctcgctcggcatcgcgatctccgaagcggtggaagtcgccgccaag
aacccggacatcaagtacgcgctgggttcggtgctcaaccacgtgatgctgcaccagacc
atcatcggcgaagaagcgatcaagcagttcgaactggcgggcgatgatccggacgtcgtg
atcggctgcgccggcggcggttcgaacttcgccggtctggccttcccgttcctcggcctg
cagctccgcggcggccgcaagcggcgcatcatcgcggtcgaaccggcggcgtgcccgacc
ctgacccgcggcacctatgcctacgacttcggcgacaccgcgcatctcaccccgctggtg
aagatgcatacgctcggctcaaccttcatgccgccgggcttccacgccggcggtctgcgc
taccacggcatgagcgggatggtgtcgcacgcctacgaactcggcctgatcgaagcccgc
gcctacaagcaggtcggctgcttcgaagccggcgtgcagttcgcccgcaccgaaggcatc
gtgccggcgccggagtccacccacgcggtccgctgcgccatcgacgaggcgctgcgctgc
aaggaggagggcaagtcggaaacgatcctgttcaacctctccggccacggccacttcgac
atgcaggcctacatcaactacttcgaaggcaagctggtcgatcaggactacgacgaagcc
gacctcgccactgcgctggccggcctgccggcggtggcggcgtaa

DBGET integrated database retrieval system