KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1815Help
Entry
Rpal_1815         CDS       T00722                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rpal_1815
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Rpal_1815
Transfer RNA biogenesis [BR:rpt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Rpal_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1949016..1949843)
Genome map
AA seq 275 aa AA seqDB search
MTAAFEQPAVVSAEHAAALLEPLTKLVLRAGAAIMAIPRDAKVTQKPDGSPVTPADLAAD
QVIAEGLAQIAPHVPVLSEECCGNGRPTSGSFFVVDPLDGTKEYIAGRNEFTVNLALVCD
GVPVLGIIGAPARGLAWRGVVGHGAEQLTVAADGVSFAATAIRTRPLPQPGEPWTATVSR
SHLDPATVAFIDARPSAVRTTLGSSLKFCWIAEGKADIYPRLAPICEWDIAAGAALVIAA
GGKVTDATGAPLRFDAPRPNFIVPEFIAWGDPDGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcgttcgaacagcccgccgtcgtttcggccgagcacgccgccgctttgctc
gaaccgctcaccaagctggtgctgcgcgccggggcggcgatcatggcgatcccgcgcgac
gccaaggtcactcagaagccggacggctcgccggtgacgcccgccgatctcgccgctgac
caggtgatcgccgaggggctggcgcagatcgctccgcacgtcccggtgctgtccgaagaa
tgttgcggcaatggacgaccgacgtcgggcagcttcttcgtggtcgatccgctcgacggc
accaaggagtacatcgccggccgcaacgaattcaccgtcaacctggcgctggtgtgcgac
ggggtgccggtgctcggcatcatcggcgcgccggctcgagggctggcgtggcgcggcgtg
gtcggccatggcgctgagcaactgactgtcgccgcggacggggtcagctttgcagccacc
gccatccggaccaggccgctgccgcagccgggcgagccgtggaccgcaacggtcagccgg
tcgcatctcgatcccgccaccgtcgccttcatcgacgcccgccccagcgccgtgcgcacg
acgctgggttcgtcgctgaaattctgctggatcgccgaaggcaaggccgacatctacccg
cggctggcgccgatctgcgagtgggatatcgcggcgggcgctgcgctggtcatcgccgcg
ggcggcaaggtgaccgacgcgaccggcgcgccgttgcggttcgacgcaccgcggccgaac
ttcatcgtgcccgaattcatcgcctggggcgaccctgacggtcgctag

DBGET integrated database retrieval system