KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1820Help
Entry
Rpal_1820         CDS       T00722                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_1820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rpal_1820
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rpal_1820
Two-component system [BR:rpt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rpal_1820
Bacterial motility proteins [BR:rpt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rpal_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1954709..1955821
Genome map
AA seq 370 aa AA seqDB search
MIVDDSVVIRGLISRWVEAEPDMVVAASLRTGLDAVNQLERVKPDVAVLDIEMPELDGIS
ALPQLLAKKRDLVVIMASTLTRRNAEISFKALSLGAADYIPKPETTREPQAADIFKHDLL
QKIRSLGGRVRRRAVPGVAAPAIAREPHPAPLPHPAVATPTVASQAALVKRSFGPTAPRV
LLIGSSTGGPQALMSMVADIGPVIDRFPVLITQHMPPTFTTILAEHLARASRRPAHEGIE
GEAIKPGNIYLAPGGKHMRVAKQGGNPVIALDDGPPVNFCKPAVDPLFMSAIEVWQGGIL
AVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAVANAGVCAAVLPLNQIGPK
VVRLFAGDRS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgacgactcggtcgtcatccgcggcttaatctccagatgggtcgaggctgag
ccggacatggtggtggcggcctcgctgcgcaccgggcttgacgccgtcaatcagcttgaa
cgggtgaagccggacgttgctgtgctcgacatcgaaatgccggaactcgacggcatttcg
gcgttgccgcagttgcttgccaaaaagcgcgatctggttgtgatcatggcgtcgacgctg
acccgccgcaacgcggagatcagcttcaaggcgctctcgctcggcgccgccgattacatt
ccgaagccggaaaccactcgcgagccgcaggccgccgacatctttaagcacgatctgctg
cagaagatccgttcgctcggcggccgggttcgtcgccgcgccgtacccggagtagctgcg
ccggcgatcgcgcgtgaaccgcatccggcgccgctgccgcatcccgcagtggctactccg
accgttgccagccaagctgcgctggtgaagcgctcgttcggtccgaccgcgccgcgcgtt
ctactgatcggctcgtcgaccggtgggccgcaggcgctgatgtcgatggtggccgatatc
ggtccggtgatcgatcgttttcccgtgttgatcacccagcacatgccgccgaccttcacg
accatcctggccgagcaccttgcgcgtgccagtcggcgcccggcgcatgaaggcatcgaa
ggcgaagccatcaagcccggtaacatctatctcgcccccggcggcaagcacatgcgcgtc
gccaagcagggcggcaatccggtgatcgcgctcgacgacggcccgccggtgaacttctgc
aagcctgcggtcgatccgctgtttatgtctgcgatcgaagtgtggcagggcggcattctc
gccgtggtgctgaccggcatggggtcggacggtatgcgcggcggcaaggacatcgtcgcc
gctggcggcagcgtgatcgcccaggacgaagcctccagcgtggtctggggcatgccgggt
gcggtcgccaatgcgggcgtctgcgccgcggtgctgccgctcaatcagatcgggcccaaa
gtggtgcgcctgttcgcaggagaccgctcgtga

DBGET integrated database retrieval system