KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1820Help
Entry
Rpal_1820         CDS       T00722                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt02020  Two-component system
rpt02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_1820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rpal_1820
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rpal_1820
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Rpal_1820
Two-component system [BR:rpt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rpal_1820
Bacterial motility proteins [BR:rpt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rpal_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACF00346
JGI: Rpal1820
UniProt: B3Q8E6
Position
1954709..1955821
Genome map
AA seq 370 aa AA seqDB search
MIVDDSVVIRGLISRWVEAEPDMVVAASLRTGLDAVNQLERVKPDVAVLDIEMPELDGIS
ALPQLLAKKRDLVVIMASTLTRRNAEISFKALSLGAADYIPKPETTREPQAADIFKHDLL
QKIRSLGGRVRRRAVPGVAAPAIAREPHPAPLPHPAVATPTVASQAALVKRSFGPTAPRV
LLIGSSTGGPQALMSMVADIGPVIDRFPVLITQHMPPTFTTILAEHLARASRRPAHEGIE
GEAIKPGNIYLAPGGKHMRVAKQGGNPVIALDDGPPVNFCKPAVDPLFMSAIEVWQGGIL
AVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAVANAGVCAAVLPLNQIGPK
VVRLFAGDRS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgacgactcggtcgtcatccgcggcttaatctccagatgggtcgaggctgag
ccggacatggtggtggcggcctcgctgcgcaccgggcttgacgccgtcaatcagcttgaa
cgggtgaagccggacgttgctgtgctcgacatcgaaatgccggaactcgacggcatttcg
gcgttgccgcagttgcttgccaaaaagcgcgatctggttgtgatcatggcgtcgacgctg
acccgccgcaacgcggagatcagcttcaaggcgctctcgctcggcgccgccgattacatt
ccgaagccggaaaccactcgcgagccgcaggccgccgacatctttaagcacgatctgctg
cagaagatccgttcgctcggcggccgggttcgtcgccgcgccgtacccggagtagctgcg
ccggcgatcgcgcgtgaaccgcatccggcgccgctgccgcatcccgcagtggctactccg
accgttgccagccaagctgcgctggtgaagcgctcgttcggtccgaccgcgccgcgcgtt
ctactgatcggctcgtcgaccggtgggccgcaggcgctgatgtcgatggtggccgatatc
ggtccggtgatcgatcgttttcccgtgttgatcacccagcacatgccgccgaccttcacg
accatcctggccgagcaccttgcgcgtgccagtcggcgcccggcgcatgaaggcatcgaa
ggcgaagccatcaagcccggtaacatctatctcgcccccggcggcaagcacatgcgcgtc
gccaagcagggcggcaatccggtgatcgcgctcgacgacggcccgccggtgaacttctgc
aagcctgcggtcgatccgctgtttatgtctgcgatcgaagtgtggcagggcggcattctc
gccgtggtgctgaccggcatggggtcggacggtatgcgcggcggcaaggacatcgtcgcc
gctggcggcagcgtgatcgcccaggacgaagcctccagcgtggtctggggcatgccgggt
gcggtcgccaatgcgggcgtctgcgccgcggtgctgccgctcaatcagatcgggcccaaa
gtggtgcgcctgttcgcaggagaccgctcgtga

DBGET integrated database retrieval system