KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1869Help
Entry
Rpal_1869         CDS       T00722                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rpal_1869
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpal_1869
Enzymes [BR:rpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Rpal_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2006587..2008938
Genome map
AA seq 783 aa AA seqDB search
MPDVLSNDLLQKMDAYWRAANYLSVGQIYLQDNPLLDQKLQLDHIKPRLLGHWGTTPGLN
LLYVHLNRLITEHDLDMIYITGPGHGGPGLVANAYLEGTYTERYPAIERSRNGMQRLFRQ
FSWPHGVPSHVSPETPGSIHEGGELGYSLAHAYGAAFDNPNLIVACVVGDGEAETGALAT
SWHSNKFLNPARDGAVLPILHLNGFKIANPTVLARITPQELTDLMRGYGYEPHFVEGDDP
AVVHQTLAATLERVLGEIRAIQDKARNHGDTERPRWPMIVMRTPKGWTGPKQVDGKPVEG
TWRAHQVPIADFKNPEHLTLLEDWMRSYRPDELFDATGKLRDELQALAPTGRRRMSANPH
ANGGELLEPLSLPDFHDYAVTLTGPGALKAEATRVLGTFLRDVMKNSLESENFRLFGPDE
TASNRLDAVLQVSPKEWMAAIEDVDVDLSPDGRVMEVLSEHLCQGWLEGYLLTGRHGFFS
CYEAFIHIIDSMFNQHAKWLKACATIPWRKPIASLNYLLTSHVWRQDHNGFSHQDPGFID
HVANKKSNVVRIYLPPDANCLLSVADHCLRSRNYVNLIVAGKQPEWQWLDIDAAVRHCTT
GAGIWHWASDEGEPDVVMACAGDVPTVETLAAVKLLREYVPDIKIRVVNVVDLMVLQPSS
EHPHGLDDRRFDELFTTDKPVIFAFHGYPWLIHRLTYRRRNHVNIHVRGYKEEGTTTTPF
DMVVLNDLDRYRLALDAILRIPRLADQRDAATSRYWATMQRHKLYIGEHGDDLPEVRDWR
WSA
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgtgttgtccaacgatctgttgcagaagatggacgcctattggcgcgccgcg
aactacctgtctgtcggacagatctatctgcaggacaatccgctactcgatcagaagctg
caactcgaccacatcaagccgcgcctgcttggccactggggtacgacccccggcctcaat
cttctctacgtgcatctcaaccggctgatcaccgagcatgatctcgatatgatctacatt
accggtcccggccatggcgggcccggcctggttgccaacgcgtatctggaaggcacctac
accgagcgctatccggcgatcgagcgcagccgcaacggcatgcagcggctgttccgacaa
ttctcgtggccgcacggcgtgccgagccacgtctcgccggaaacgcccggctcgatccac
gagggcggcgaactcggctactcgctggcgcatgcctatggcgcggcgttcgacaatccg
aatctgatcgtcgcttgcgtggtcggcgacggcgaggccgagaccggcgctctggcgacg
agttggcactccaacaagtttctcaatcccgcgcgcgacggcgcggtgttgccgatcctg
catctgaacggcttcaagatcgccaacccgaccgtgctggcgcggatcacgccgcaggaa
ctcaccgacctgatgcgcggctatggctatgagccgcacttcgtcgaaggcgacgatccg
gcggtggtgcaccagacgctggctgcgacgctggaacgcgtgctcggcgagatccgggcc
attcaggacaaggctcgcaaccacggcgacaccgagcggccgcgctggccgatgatcgtg
atgcggaccccaaaggggtggaccggccccaagcaggtcgacggcaagccggtggagggc
acctggcgcgcccatcaggtgccgatcgcggacttcaagaaccccgagcatctgacgctg
ctcgaagattggatgcgcagctatcggcccgatgagctgttcgacgccaccggcaagctg
cgcgacgagctgcaggcgctggcgccgaccggccgtcgccggatgagcgccaatccgcac
gccaatggcggcgaattgctggagccgctgtcgctgcccgatttccacgactatgcggtg
acgctcaccgggcccggcgcgctgaaggccgaggcgacgcgggtgctcggcacgttcctg
cgcgacgtgatgaagaacagcctcgagagcgaaaacttccgcttgttcggcccggacgaa
accgcctcgaaccggctcgatgcggtgctgcaagtctcgccgaaggagtggatggcggcg
atcgaggatgtcgacgtcgatctcagtccggacggccgggtgatggaggtgctcagcgag
catctatgccaaggctggctcgaaggctatctgctgaccggccgccacggcttcttctcg
tgctacgaggcgttcatccacatcatcgactcgatgttcaatcagcacgccaaatggcta
aaggcgtgcgccacgattccgtggcggaagccgatcgcgtcgctgaactatctgctgacc
tcgcacgtctggcgccaagatcacaacgggttctcgcaccaggatcccggcttcatcgac
cacgtcgccaacaagaagtcgaatgtggtgcggatctatctgccgccggatgccaactgt
ctgctgtcggtggccgaccactgcctgcgcagccgcaactacgtcaacctgatcgtcgcc
ggcaagcagccggaatggcagtggctcgatatcgacgccgccgtccgtcactgcaccaca
ggcgccgggatctggcattgggcgagcgacgagggtgagcccgacgtggtgatggcctgc
gccggcgacgtgccgacggtcgagacgctggcggcggtcaagctgctgcgggagtacgtg
ccggacatcaagatccgtgtcgtcaacgtggtcgacctgatggtgctgcagccgagctcc
gagcatccgcacggcctggacgaccgccgcttcgacgagctgttcaccaccgacaagccg
gtgatcttcgccttccacggctatccgtggctgatccaccggctgacctatcgccgccgc
aaccacgtcaacatccacgtccgcggctacaaggaagagggcaccaccaccacgccgttc
gacatggtggtgctgaacgatctcgaccgttatcgcctggcactcgacgccatcctgcgg
attccgcggctcgccgatcagcgcgatgccgccacctcgcgctactgggcgacgatgcag
cggcacaagctgtatatcggcgaacacggcgacgatctgccagaggttcgcgactggcgc
tggtcggcctga

DBGET integrated database retrieval system