KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1921Help
Entry
Rpal_1921         CDS       T00722                                 

Definition
LysR family transcriptional regulator
Organism
rpt  Rhodopseudomonas palustris TIE-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2070052..2070969
Genome map
AA seq 305 aa AA seqDB search
MDRLDTMTAFVAVADLQGFAPAARKLGLSPSAVTRMVAALEERLGTRLLQRTTRSVALTD
TGVRYLERVRRILADVEEADTSAAAERIIPSGRLVVSAPVGFGRRHVAPLLSDYLRRYPE
VTGELRLSDLMINLVEDGVDCAVRIGHLSDSSLVARQLGAMRRIVVASPAYLAARGIPAT
PAEIAAHDVIHFGQTGAPVGWHFVVDGRDVRIACTPRLVSNVADVAILDAERGGGLTRVL
AYQAADAIAAGRLQIVLATYEVPPLPIAIVYPTSRLLSAKVRAFIDLAAETSDWRFGGDG
KRSGA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaccgattggacacgatgacggcgtttgtggccgtcgccgacctgcaaggcttcgcg
ccggctgcgcgaaaactcgggctgtcgccctccgcggtgacccggatggtcgcggccctg
gaagagcgtctcggcacccggctgttgcaacggacgacacgctcggtcgcgctgaccgat
accggcgttcgctatttggaacgggtgcggcggattttggccgacgtcgaagaggccgac
acctccgccgcggccgagcgcatcatcccatctggccggctggtggtttcggctcccgtc
ggcttcggccggcgtcatgttgcgccgctgctgtcggactatctgcgacgctacccggag
gtgaccggcgagttgcggctgtcggacctgatgatcaacctggtcgaggacggtgtcgat
tgcgcggtccggatcggacatctgtcggattcaagcctggtggcgcggcagctcggcgcc
atgcgccggatcgtggtggcctcgccggcctatttggcggcgcgcggcattccggccacg
ccggcagagatcgcggcgcacgatgtgatccatttcggccagaccggcgcgccggtcggc
tggcacttcgtcgtcgacggccgcgatgtccgcatcgcctgcacgcctcgcctcgtcagt
aatgtcgccgacgtcgcgatcctggatgccgagcggggcggcggcctgacccgcgtgctg
gcctatcaggcggcggacgcgatcgcggcggggcggctgcagatcgtgctggcgacctac
gaagtgccaccgttgccgattgcgatcgtctatccaacctcgcggctgttgtcggcgaag
gttcgggccttcatcgatcttgcggcggagacgagcgactggcgcttcggcggtgatggg
aagaggagcggggcgtga

DBGET integrated database retrieval system