KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2044Help
Entry
Rpal_2044         CDS       T00722                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00790  Folate biosynthesis
rpt01100  Metabolic pathways
Module
rpt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpal_2044
Enzymes [BR:rpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rpal_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CAT_RBD DUF5304 Adeno_E3A
Motif
Other DBs
NCBI-ProteinID: ACF00567
JGI: Rpal2044
UniProt: B3QAN0
Position
complement(2214850..2215707)
Genome map
AA seq 285 aa AA seqDB search
MTASPSLPASPAAPAKPSQQRDLLVRPAAAVMGILNVTPDSFSDGGDYLAPEQACAHAAE
MIADGAEIIDIGAESTRPYGSQPVSAAEELRRLQPVLEAVVALGTPVSIDTMKADVAAWA
LDHGAAIANDVWGLQRDPEMAGVIAARRAPVIVMHNRDAADPAIDIVADINAFFERSMTI
ATKAGIAEELIVLDPGIGFGKTPQQSMITLARLREFASFGRPLLVGASRKRFISTVVPSE
PKQRLGGSLAAHLIAVENGAKIIRAHDVAATSQALKVAHAIRDSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccccttcgctgcccgcatcgcccgccgctccggccaagccgtcacagcag
cgcgatctgctggtgcgtcccgccgcggcggtgatgggcattctcaacgtcacaccggat
tctttctctgacggcggcgattatctcgcccccgagcaggcctgcgcccatgcggccgag
atgatcgccgatggcgccgagatcatcgacatcggtgcggagtccacccgcccctacggc
tcgcagccggtgtccgccgctgaagagctgcggcggctgcagcccgtgctggaagcggtg
gtggcgctcggcacgccggtgtcgatcgacaccatgaaggccgacgtcgccgcctgggca
ctcgaccatggtgccgcgatcgccaacgacgtgtggggattgcagcgcgatccggagatg
gcgggcgtgattgcagcgcgccgcgccccggtgatcgtgatgcacaatcgcgacgcggcc
gatccagccatcgacatcgtcgccgacatcaacgcgttcttcgaacgttcgatgacgatc
gccacgaaggccgggatcgccgaggagctgatcgtgctcgatcccggcatcggcttcggc
aagacgccgcagcagagcatgatcacgctggcgcggctgcgcgagttcgcaagcttcggc
cgcccgctgctggtcggcgcctcgcgcaagcgcttcattagtacggtggtgccgagcgag
ccgaagcagcggctcggcggttcgctcgccgcgcatctcatcgcggtcgagaacggcgcc
aagatcatccgcgcgcacgacgtcgccgcgacgtcgcaggcattgaaagtcgcccacgcc
atcagggacagccgatga

DBGET integrated database retrieval system