KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2044Help
Entry
Rpal_2044         CDS       T00722                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2214850..2215707)
Genome map
AA seq 285 aa AA seqDB search
MTASPSLPASPAAPAKPSQQRDLLVRPAAAVMGILNVTPDSFSDGGDYLAPEQACAHAAE
MIADGAEIIDIGAESTRPYGSQPVSAAEELRRLQPVLEAVVALGTPVSIDTMKADVAAWA
LDHGAAIANDVWGLQRDPEMAGVIAARRAPVIVMHNRDAADPAIDIVADINAFFERSMTI
ATKAGIAEELIVLDPGIGFGKTPQQSMITLARLREFASFGRPLLVGASRKRFISTVVPSE
PKQRLGGSLAAHLIAVENGAKIIRAHDVAATSQALKVAHAIRDSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccccttcgctgcccgcatcgcccgccgctccggccaagccgtcacagcag
cgcgatctgctggtgcgtcccgccgcggcggtgatgggcattctcaacgtcacaccggat
tctttctctgacggcggcgattatctcgcccccgagcaggcctgcgcccatgcggccgag
atgatcgccgatggcgccgagatcatcgacatcggtgcggagtccacccgcccctacggc
tcgcagccggtgtccgccgctgaagagctgcggcggctgcagcccgtgctggaagcggtg
gtggcgctcggcacgccggtgtcgatcgacaccatgaaggccgacgtcgccgcctgggca
ctcgaccatggtgccgcgatcgccaacgacgtgtggggattgcagcgcgatccggagatg
gcgggcgtgattgcagcgcgccgcgccccggtgatcgtgatgcacaatcgcgacgcggcc
gatccagccatcgacatcgtcgccgacatcaacgcgttcttcgaacgttcgatgacgatc
gccacgaaggccgggatcgccgaggagctgatcgtgctcgatcccggcatcggcttcggc
aagacgccgcagcagagcatgatcacgctggcgcggctgcgcgagttcgcaagcttcggc
cgcccgctgctggtcggcgcctcgcgcaagcgcttcattagtacggtggtgccgagcgag
ccgaagcagcggctcggcggttcgctcgccgcgcatctcatcgcggtcgagaacggcgcc
aagatcatccgcgcgcacgacgtcgccgcgacgtcgcaggcattgaaagtcgcccacgcc
atcagggacagccgatga

DBGET integrated database retrieval system