KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2351Help
Entry
Rpal_2351         CDS       T00722                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00910  Nitrogen metabolism
rpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rpal_2351
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rpal_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 Copper-bind TAT_signal Cu-oxidase_2
Motif
Other DBs
NCBI-ProteinID: ACF00866
JGI: Rpal2351
UniProt: B3QDW5
Position
2538742..2540679
Genome map
AA seq 645 aa AA seqDB search
MGDQDHEHGLSRRTLLGSSAVAAGVGLVGGATLGTGGTLIATAEAQTKPSSPARPAFQKS
EVHPGELDEYYVFFSSGQTGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKILTEG
LLPESREFLKTRGGTYVNGDLHHPHLSFTEGTYDGRYAFMNDKANTRVARVRLDVMKCDK
IIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDGHNLKKTKDYHAIFTAVDGDTMK
VAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVTAAEMTANDQDWVVIFNLKRIEEAVK
KGDFKEMGGVPVIDGRHGSPYTRYVPVPNGPHGMNTAPDGIHIVANGKLSPTVTVMDVRL
FDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNGYTTLFIDSQICKWNIDLAKRAYKG
EKANPIIDKLDVHYQPGHNHTSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQLID
ISGEKMKLVHDGPSFAEPHDATIVHRSKINPISVWDRADPMFSDAVKQAQADGVKLEEDS
KVIREGDKVRVYIVATAPNFGLTEFDVKQGDHVTVYVTNIDTVEDLTHGFSIVNYGIQME
VAPHATASVSFTADRPGVYWYYCSWFCHAMHMEMKGRMLVEPRSV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccaggatcacgaacacggccttagccgacgaacgctactcggaagcagtgcc
gtcgcagccggcgtcggcctcgtcggcggcgccaccctcggcaccggcggcacgctgatc
gccactgccgaagcgcagaccaagccgagcagcccggcgcgcccggcgtttcagaagagc
gaagtccatccgggcgagctcgacgagtactacgtgttcttctccagcggccagaccggc
gagctccggatcgtcggtctgccgtcgatgcgcgaactgatgcgggtcccggtgttcaac
cgctgcagcgccaccggctggggccagaccaatgagagcctcaagattctgaccgagggg
cttttgcctgagagccgcgagttcctgaagacccgtggtggtacctatgtcaacggcgac
ctgcatcacccgcatctgtcgttcaccgaaggcacctatgacggccgctacgccttcatg
aacgacaaggccaatacccgtgtggcgcgggtccggctcgacgtgatgaagtgcgacaag
atcatccagctgccgaaccagcacaccgtgcacggcctgcgcgtccagaaatatccgcgc
accggctacgtgttctgcaacggcgaagaccgcgttccgctgccgaacgacggccacaac
ctgaagaagaccaaggactaccacgcgatcttcaccgcggtcgacggcgacaccatgaag
gtggcctggcaggtgatggtcgacggcaacctcgacaacgtcgatgccgactaccaggga
aaatacgcgttcgcgacctgctacaactcggaggagggtgtcaccgccgccgagatgacc
gccaacgaccaggactgggtggtgatcttcaatctcaagcggatcgaagaggcggtgaag
aagggcgacttcaaggaaatgggtggcgtaccggtgatcgatggccgccacggctcgccc
tacacccgctacgtgccggtgccgaacggcccgcacggcatgaacaccgcgccggacggc
atccacatcgtcgccaacggcaagctgtcgccgaccgtgacggtgatggacgtgcgacta
ttcgaccagctgttcgacgacaagatcaagccgcgtgacgtcgtggtcgccgagccggag
ctcggcctcggcccgctgcacactgcctatgacggcaagggcaacggctacaccacgctg
ttcatcgacagccagatctgcaagtggaacatcgatttggccaagcgcgcctacaaaggc
gagaaggccaatccaatcatcgacaagctcgatgtgcactatcagcccggccacaaccac
acctcgatgggccagaccaaggaagccgatggaaagtggctgatctcgctgaacaagttc
tccaaggaccggttcctcaacgtcggcccgcttaagccggagaacgatcagctgatcgac
atttccggagagaagatgaagcttgtgcacgacggcccgagcttcgcggagccgcacgac
gcaaccatcgtccatcgctccaaaatcaatccgatctcggtctgggatcgggccgatccg
atgttctccgatgcggtgaagcaggctcaagccgacggcgtgaagctggaggaagattcc
aaggtgatccgcgagggtgacaaggtgcgggtctatatcgtggcgaccgcgccaaacttc
ggtcttaccgagttcgacgtgaagcagggcgatcacgtcaccgtctatgtcaccaacatt
gatacggtcgaagacctcacccacggcttctcgatcgtcaactacggcatccagatggaa
gtcgcgccgcacgcgactgcgtcggtgtcgttcacggccgatcgtcccggtgtgtactgg
tattattgctcctggttctgtcatgccatgcacatggagatgaagggccgcatgctggtc
gagccgcggagcgtctga

DBGET integrated database retrieval system