KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2545Help
Entry
Rpal_2545         CDS       T00722                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpal_2545
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_2545
   00620 Pyruvate metabolism
    Rpal_2545
   00640 Propanoate metabolism
    Rpal_2545
  Energy metabolism
   00680 Methane metabolism
    Rpal_2545
Enzymes [BR:rpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rpal_2545
Lipid biosynthesis proteins [BR:rpt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rpal_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2750140..2751831
Genome map
AA seq 563 aa AA seqDB search
MSNTHPAVAAIEDYADVLARFRREDLEALFDGNFAIGINVCIECCDRHVAGGGTALDWES
QDGRTASFSFAEMKDYAARVANLLVAQGVKPGDVVAGMLPRTPELLALILGTWRAGAVYQ
PLFTAFGPKAIEHRVKMSAAKLVVTDLANRAKLADVADCPTVAIVLRPGETAPLGDLDFH
AEIAAQSTEFAPVLRKGTDLFLMMSTSGTTGLPKGVPVPINALPAFYSYIRDAVDLRAGD
IFWNIADPGWAYGLYYAVTGPLLHGHATTFYDGPFTAESTYGLIKRRGITNLAGAPTAYR
LLIAAGPEAAAPVKGQLRVVSSAGEPLNPEVIRWFAEHLAAPIHDHYGQTELGMVVNNHH
RLRHTVHPGSAGLAMPGFRVAVLDEHSNELPPNVPGVLSVDLKRSPLMWFSGYWQQETPA
IEGGYYRTGDTVELEPDGSISFVGRADDVITSSGYRIGPFDVESALIEHAAVIEAAVIGK
PDPERTEIVKAYVVLAKDVTPSEALAEELRQYVKKRLSAHAYPREIEFLEQLPKTPSGKL
QRFILRKRDTEPASTTQGSSSAA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacccatcctgcggtcgcagccattgaagattatgccgacgtcctggcgcgg
tttcgccgcgaggacctcgaagccctgttcgacggcaacttcgcgatcggcatcaacgtc
tgcatcgaatgctgcgaccgtcacgtcgccggcggcggcacggcactggattgggagagc
caggacggccgcaccgcgtccttcagctttgccgagatgaaggactatgcggcccgcgtc
gccaatctgctggtcgcgcagggcgtgaagcccggcgacgtcgtcgccggcatgctgccg
cggacgcccgaactgctggcgctgatcctcggcacctggcgcgccggtgcggtctatcag
ccgctgttcaccgcgttcggtccgaaggcgatcgagcaccgcgtcaagatgagcgccgcc
aagctggtggtcaccgatctggccaaccgcgccaagctcgccgacgtcgccgattgcccg
accgtcgcgatcgtgctccggccgggcgagaccgcgccgctcggcgatctcgatttccat
gccgagatcgcggcgcaatcgaccgaattcgctccggtgctgcgcaagggcaccgacctg
ttcctgatgatgtcgacctccggcaccaccggtctgccgaagggcgtgccggtgccgatc
aacgcgctgccggcgttctattcgtacatccgtgatgcggtcgatctgcgcgcgggcgac
atcttctggaacatcgccgatccgggctgggcctatggcttgtactacgcggtcactggc
ccgctgctgcacggccacgccaccaccttctacgacggtccgttcaccgccgagagcacc
tatggcctgatcaagcgccgcggcattaccaacctcgccggtgcgccgaccgcgtatcgg
ctgctgatcgcagcgggtccggaagcggcggcgccggtgaagggccagctccgcgtcgtc
tctagcgccggcgagccgctcaatcccgaagtgatccgctggtttgccgagcatctcgcc
gcgccgatccacgatcattacggccagaccgagctcggcatggtggtcaacaatcatcac
cgcctgcgccacaccgtgcatccgggttccgccgggctcgcgatgccgggcttccgcgtc
gcggtgctcgacgagcacagcaacgaactgccgccgaacgtcccgggcgtgctcagcgtc
gatttgaagcgttcgccgctgatgtggttctccggctactggcagcaggagacgccggcg
atcgaaggcggttactaccgcaccggcgacaccgtcgaactggagccggatgggtcgatc
agcttcgtcggccgggccgacgacgtcatcacctcgtcgggctatcgcatcggtccgttc
gacgtcgagagcgcgctgatcgaacacgccgcggtcatcgaggcggcggtgatcggcaag
cccgatcccgagcgcaccgagatcgtcaaagcctatgtggtgctcgccaaggacgtgacg
ccgagcgaagctctggccgaggagctgcggcaatacgtcaagaagcggctctccgcgcac
gcctatccgcgcgagatcgaattcctggagcaactcccgaagacgccgagcggcaagctg
cagcgcttcattctgcgcaagcgcgacaccgaacccgcgagcacgacccagggctcttct
tctgcagcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system