KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2545Help
Entry
Rpal_2545         CDS       T00722                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00620  Pyruvate metabolism
rpt00640  Propanoate metabolism
rpt00680  Methane metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_2545
   00620 Pyruvate metabolism
    Rpal_2545
   00640 Propanoate metabolism
    Rpal_2545
  Energy metabolism
   00680 Methane metabolism
    Rpal_2545
Enzymes [BR:rpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rpal_2545
Lipid biosynthesis proteins [BR:rpt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rpal_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACF01058
JGI: Rpal2545
UniProt: B3QFI5
Position
2750140..2751831
Genome map
AA seq 563 aa AA seqDB search
MSNTHPAVAAIEDYADVLARFRREDLEALFDGNFAIGINVCIECCDRHVAGGGTALDWES
QDGRTASFSFAEMKDYAARVANLLVAQGVKPGDVVAGMLPRTPELLALILGTWRAGAVYQ
PLFTAFGPKAIEHRVKMSAAKLVVTDLANRAKLADVADCPTVAIVLRPGETAPLGDLDFH
AEIAAQSTEFAPVLRKGTDLFLMMSTSGTTGLPKGVPVPINALPAFYSYIRDAVDLRAGD
IFWNIADPGWAYGLYYAVTGPLLHGHATTFYDGPFTAESTYGLIKRRGITNLAGAPTAYR
LLIAAGPEAAAPVKGQLRVVSSAGEPLNPEVIRWFAEHLAAPIHDHYGQTELGMVVNNHH
RLRHTVHPGSAGLAMPGFRVAVLDEHSNELPPNVPGVLSVDLKRSPLMWFSGYWQQETPA
IEGGYYRTGDTVELEPDGSISFVGRADDVITSSGYRIGPFDVESALIEHAAVIEAAVIGK
PDPERTEIVKAYVVLAKDVTPSEALAEELRQYVKKRLSAHAYPREIEFLEQLPKTPSGKL
QRFILRKRDTEPASTTQGSSSAA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacccatcctgcggtcgcagccattgaagattatgccgacgtcctggcgcgg
tttcgccgcgaggacctcgaagccctgttcgacggcaacttcgcgatcggcatcaacgtc
tgcatcgaatgctgcgaccgtcacgtcgccggcggcggcacggcactggattgggagagc
caggacggccgcaccgcgtccttcagctttgccgagatgaaggactatgcggcccgcgtc
gccaatctgctggtcgcgcagggcgtgaagcccggcgacgtcgtcgccggcatgctgccg
cggacgcccgaactgctggcgctgatcctcggcacctggcgcgccggtgcggtctatcag
ccgctgttcaccgcgttcggtccgaaggcgatcgagcaccgcgtcaagatgagcgccgcc
aagctggtggtcaccgatctggccaaccgcgccaagctcgccgacgtcgccgattgcccg
accgtcgcgatcgtgctccggccgggcgagaccgcgccgctcggcgatctcgatttccat
gccgagatcgcggcgcaatcgaccgaattcgctccggtgctgcgcaagggcaccgacctg
ttcctgatgatgtcgacctccggcaccaccggtctgccgaagggcgtgccggtgccgatc
aacgcgctgccggcgttctattcgtacatccgtgatgcggtcgatctgcgcgcgggcgac
atcttctggaacatcgccgatccgggctgggcctatggcttgtactacgcggtcactggc
ccgctgctgcacggccacgccaccaccttctacgacggtccgttcaccgccgagagcacc
tatggcctgatcaagcgccgcggcattaccaacctcgccggtgcgccgaccgcgtatcgg
ctgctgatcgcagcgggtccggaagcggcggcgccggtgaagggccagctccgcgtcgtc
tctagcgccggcgagccgctcaatcccgaagtgatccgctggtttgccgagcatctcgcc
gcgccgatccacgatcattacggccagaccgagctcggcatggtggtcaacaatcatcac
cgcctgcgccacaccgtgcatccgggttccgccgggctcgcgatgccgggcttccgcgtc
gcggtgctcgacgagcacagcaacgaactgccgccgaacgtcccgggcgtgctcagcgtc
gatttgaagcgttcgccgctgatgtggttctccggctactggcagcaggagacgccggcg
atcgaaggcggttactaccgcaccggcgacaccgtcgaactggagccggatgggtcgatc
agcttcgtcggccgggccgacgacgtcatcacctcgtcgggctatcgcatcggtccgttc
gacgtcgagagcgcgctgatcgaacacgccgcggtcatcgaggcggcggtgatcggcaag
cccgatcccgagcgcaccgagatcgtcaaagcctatgtggtgctcgccaaggacgtgacg
ccgagcgaagctctggccgaggagctgcggcaatacgtcaagaagcggctctccgcgcac
gcctatccgcgcgagatcgaattcctggagcaactcccgaagacgccgagcggcaagctg
cagcgcttcattctgcgcaagcgcgacaccgaacccgcgagcacgacccagggctcttct
tctgcagcttga

DBGET integrated database retrieval system