KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2728Help
Entry
Rpal_2728         CDS       T00722                                 

Definition
Rne/Rng family ribonuclease
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
RNA degradation
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:rpt03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2959788..2962949)
Genome map
AA seq 1053 aa AA seqDB search
MANKMLIDATHPEETRVVVVRGNRVEEFDFETAQRKQLRGNIYLAKVTRVEPSLQAAFIE
YGGNRHGFLAFSEIHPDYYQIPVADRQALIEADERAHREAEEENEQRSSRRRSRHRSHRR
RNNGERVQSEIVEAATDVAAEQPHEAADHHEAHEAGAHAEAERLMHELPEGETAEQHDAE
YAADHEHTHVEAAPSEPQVSAAAEPVTIEQPAAAEAPAPVEAPQAAASHDETDAHDDDHG
EDSANYAEDAPFPIDEHHEAEDEHEAHDDHVEGEHEVETDSDSDTEAEAEDDEEEDDEEE
AEEDVVESVGGDDVLEEVPERAFRPRRQYKIQEVIKRRQVMLVQVVKEERGNKGAALTTY
LSLAGRYAVLMPNTARGGGISRKITSAQDRSRLKEVVQDLDVPEGMGVILRTAGASRTKP
EIKRDFEYLIRMWETVRDVTLNSQAPKLVYEEGSLIKRSLRDLYNKEIDEVLVAGEAGYR
EARDFMHMLMPSQVRAVKLYRDGQPLFSRMGVESQLDAMFSPTVQLRSGGYIVINQTEAL
VSIDVNSGRSTREHHIEDTALKTNMEAAEEVARQLRLRDLAGLIVIDFIDMDEKRNNRAV
ERKLSDCLRQDRARIQVGRISHFGLLEMSRQRIRASVLESSTEPCPHCGGSGHVRSVSSV
ALQLLRGLEEVLMKGATHNLIVRTRTDVALYVLNHKRGHLRDLETGFRVSLSVLADPTVS
GQQSFVIDRGEQVHTLETAKALLAAQIAASPAPLDEPEDDDGYDFEAEIETDETVGLAED
QGSEAGESESEGRKRRRRRRRRRSGEPREAAEAGAVGEDGEQPFVSEGVEQVGEADEGDE
AGEDDSDAEARADQGENGERRPRRRGRRGGRRRRGNAEAGENEAGVVGSISDELSPTDEA
EAADAVADFDGGSPSVQPSFEPAAEAEQPHDAPPHDIVPSEPQHTAATAAPDTSDPSAED
DSAAKKAARRRSTVREKVSFGASAAASETTAEAAAEVQPEPTAQAEQPATAAPAVEAPAA
EAAPQAAAQPAEEPSSAAPRRVGWWSRRFGGGN
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagatgctgatcgacgccacccacccggaagagacccgggtggtcgtggtc
cgtggcaaccgcgtcgaagagtttgatttcgaaaccgcccagcgcaaacaactccgcggc
aatatctatctcgcaaaagtcacccgggtcgaaccctcgctacaagccgccttcatcgaa
tatggcggcaatcgccacggcttcctcgccttcagcgaaatccatcccgactattatcaa
atcccggtcgccgaccggcaggccctgatcgaagccgacgaacgcgcccaccgcgaagcc
gaagaagaaaacgagcagcgctccagccgccgccggtcgcggcatcgcagccatcgccgc
cgcaacaacggcgagcgggtgcagagcgagatcgtcgaagccgctaccgacgtcgcggcc
gagcagccccacgaggctgccgaccatcacgaggcgcacgaggccggggctcacgccgag
gctgagcgcttgatgcacgagttgccggagggtgagaccgccgagcagcacgacgccgag
tacgccgccgatcacgaacacacccacgtcgaagctgctccgtccgagcctcaggtgagc
gctgcggccgagcccgtcacgatcgagcagccggcggctgccgaggctcccgcgccggtc
gaagccccgcaggcagcggcgtcgcacgacgaaaccgacgcgcacgacgacgaccacggc
gaggacagcgcgaactacgccgaggacgcgccgttcccgatcgacgagcaccacgaggcc
gaagacgaacacgaggcgcacgacgatcacgttgaaggcgagcacgaggtcgaaaccgac
tccgactccgacaccgaggcggaagccgaggacgacgaggaagaggatgacgaagaggaa
gccgaggaggacgtggtcgagtccgtcggcggtgacgacgtgctcgaggaagtgccggaa
cgcgccttccgtccgcgccggcagtacaagatccaggaagtcatcaagcgccgccaggtg
atgctggtgcaggtcgtcaaggaagagcgcggcaacaagggtgctgcgctcaccacctac
ctgtcgctcgccggccgttacgccgtgttgatgccgaacaccgcccgcggcggcggcatc
agccgcaagatcacctcggcccaggaccgctcacggctgaaggaagtggtgcaggacctc
gacgtgccggaaggcatgggcgtgatcctgcgcaccgccggcgcctcgcggaccaagccc
gagatcaagcgcgacttcgaatacctgatccggatgtgggagacggtgcgcgacgtcacg
ctgaactcgcaggcgccgaagctggtctatgaagaaggctcgctgatcaagcgctccctg
cgcgacctctacaacaaggaaatcgacgaggtgctggtcgccggcgaagccggctatcgc
gaagcccgcgacttcatgcacatgctgatgccgtcgcaggtgcgcgcggtgaagctgtat
cgtgacggccagccgctgttctcgcggatgggcgtcgagagccagctcgacgcgatgttc
tcgccgaccgtgcagctccgctccggcggctacatcgtcatcaaccagaccgaagcgctg
gtctcgatcgacgtcaactcggggcgctcgacccgcgagcaccacatcgaggacaccgcg
ctcaagaccaacatggaagccgccgaggaagtcgcccggcagctccggctgcgcgacctc
gccggcctgatcgtcatcgacttcatcgacatggacgagaagcgcaacaaccgcgcggtc
gagcgtaagctcagcgactgtctgcggcaggatcgcgctcgcatccaggtcggccgaatc
tcgcatttcggcctgctcgaaatgtcgcgccagcgcatccgcgccagcgtgctggagagc
tcgaccgagccctgcccgcattgcggcggctcgggccacgtccgctcggtctcctcggtc
gcgctgcagctgctgcgcggcctcgaagaggtgctgatgaagggcgcgacgcacaacctg
atcgtgcgcacccgcaccgacgtggcgctgtacgtcctcaaccacaagcgcggccatctg
cgcgacctcgagaccggcttccgggtatcgctgtcggtgctggccgatccgaccgtcagc
ggccagcagtcgttcgtgatcgaccgcggtgagcaggtccacacgctcgagactgccaag
gcgctcctcgccgcgcagatcgccgcctccccggcaccgctcgacgagcccgaggatgac
gacggctacgatttcgaagccgagatcgagaccgacgagaccgtcggcctcgccgaggat
cagggcagcgaagccggcgaaagcgaaagcgaaggccgcaagcgccgccgtcgccgccgg
cgtcggcggtcgggtgagccgcgtgaagccgccgaagctggtgcagtgggcgaagatggc
gagcagccgtttgtgtccgaaggcgtcgaacaggtcggcgaagctgatgaaggcgacgag
gccggcgaagacgacagcgacgccgaagcccgtgccgaccagggcgagaacggcgaacgc
cgtccgcgccgccgcggtcgtcgcggtggccgtcgccgtcgcggcaatgctgaggcaggc
gagaacgaagccggcgtggtcggctcgatcagcgacgaactctccccgacggacgaagcg
gaagctgcggacgctgtcgccgacttcgacggcggcagcccctcggtgcaacccagcttc
gaaccggctgccgaggccgagcagccgcacgacgctccgccgcacgacattgtgccgtcc
gagccgcagcacacggcagcgactgccgcacccgacaccagcgatccgtcggccgaggac
gacagcgcagcgaagaaggccgcgcgtcgccgctccacggtgcgcgaaaaggtgagcttc
ggcgcatcggccgccgcctccgaaacgacggcggaagccgcagccgaagtccagcccgag
ccgaccgctcaggccgagcagccggccacggccgcgcctgcggtggaagccccggccgcc
gaggccgcgccacaagcagccgcacaacccgcagaggagccctcctcggccgccccgcgg
cgcgtcggctggtggtcccgccgcttcggtggtggcaattaa

DBGET integrated database retrieval system