KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2754Help
Entry
Rpal_2754         CDS       T00722                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpt  Rhodopseudomonas palustris TIE-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2995318..2996385)
Genome map
AA seq 355 aa AA seqDB search
MAALQDDHDRTMAYAEVALSQIKTLRQGAVPRNYEIWYVYATGHNPELNKAINDTLAERG
NLTDADLDQLHDTYLTQGRTTDRIDRIGARVANEIDDIMALLAETLGNTASFGDDLRGES
QKLSLATDHDQIKAIVERLVVTTREMQQANSALEERLSTSKQEIANLQVSLDAIRAESLT
DPLTGLGNRKHFDRTVQEAIRNAGASQQPLSLLMMDIDHFKSFNDTYGHLTGDQVLRLVG
MTLKQSIKGQDFTARYGGEEFAVVLPNTPMRQAIIVADNIRRLVMSKELKKKSTGEILGR
VTLSAGVSTLKPNDDAEALIERADACLYAAKRNGRNRVICETDPEFAGITQAAVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgctgcaggacgaccatgaccgcaccatggcctatgccgaggtggccctctcc
cagatcaagaccctccgccaaggcgccgtgccgcgcaattacgagatctggtacgtctac
gccaccggccataatcccgagctgaacaaggcgatcaacgacacgctggcggagcgcggc
aacctcaccgacgccgacctcgatcagttgcacgatacctacctcacgcaaggccgcacc
accgaccggatcgaccggatcggcgcccgcgtcgccaacgagatcgacgacatcatggcg
ctgctcgccgagacgctcggcaacaccgccagcttcggcgacgatctgcgcggcgaaagc
cagaagctgtcgctggcgaccgaccacgatcagatcaaagcgatcgtcgagcgtctggtc
gtgaccacccgcgagatgcagcaggccaacagcgcgctcgaagagcggctgtcgacctcc
aagcaggagatcgccaatctccaggtcagcctcgatgcgatccgcgccgagagcctcacc
gatcccctcaccggcctcggcaaccgcaagcatttcgaccgcaccgtccaggaggcgatc
cgcaacgccggcgccagccagcagccactgtcgctgctgatgatggacatcgatcacttc
aagtcattcaacgacacctacggccatctcaccggcgaccaggtgctgcggctcgtcggc
atgacgctgaagcagagcatcaagggccaggacttcaccgcccgctacggcggcgaggaa
ttcgccgtggtgctgccgaacacgccgatgcgccaggcgatcatcgtcgccgacaacatc
cgccggctggtgatgtcgaaggagctgaagaagaagtcgaccggcgagatcctcggccgg
gtgacgctatcggccggcgtgtcgacgctgaagccgaatgacgatgccgaagcgctgatc
gagcgcgccgacgcctgcctctatgccgccaaacgcaacggccgcaaccgggtgatctgc
gagacagatccggaatttgccggcatcacgcaggccgccgttgcctga

DBGET integrated database retrieval system