KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2754Help
Entry
Rpal_2754         CDS       T00722                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
Enzymes [BR:rpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Rpal_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2995318..2996385)
Genome map
AA seq 355 aa AA seqDB search
MAALQDDHDRTMAYAEVALSQIKTLRQGAVPRNYEIWYVYATGHNPELNKAINDTLAERG
NLTDADLDQLHDTYLTQGRTTDRIDRIGARVANEIDDIMALLAETLGNTASFGDDLRGES
QKLSLATDHDQIKAIVERLVVTTREMQQANSALEERLSTSKQEIANLQVSLDAIRAESLT
DPLTGLGNRKHFDRTVQEAIRNAGASQQPLSLLMMDIDHFKSFNDTYGHLTGDQVLRLVG
MTLKQSIKGQDFTARYGGEEFAVVLPNTPMRQAIIVADNIRRLVMSKELKKKSTGEILGR
VTLSAGVSTLKPNDDAEALIERADACLYAAKRNGRNRVICETDPEFAGITQAAVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgctgcaggacgaccatgaccgcaccatggcctatgccgaggtggccctctcc
cagatcaagaccctccgccaaggcgccgtgccgcgcaattacgagatctggtacgtctac
gccaccggccataatcccgagctgaacaaggcgatcaacgacacgctggcggagcgcggc
aacctcaccgacgccgacctcgatcagttgcacgatacctacctcacgcaaggccgcacc
accgaccggatcgaccggatcggcgcccgcgtcgccaacgagatcgacgacatcatggcg
ctgctcgccgagacgctcggcaacaccgccagcttcggcgacgatctgcgcggcgaaagc
cagaagctgtcgctggcgaccgaccacgatcagatcaaagcgatcgtcgagcgtctggtc
gtgaccacccgcgagatgcagcaggccaacagcgcgctcgaagagcggctgtcgacctcc
aagcaggagatcgccaatctccaggtcagcctcgatgcgatccgcgccgagagcctcacc
gatcccctcaccggcctcggcaaccgcaagcatttcgaccgcaccgtccaggaggcgatc
cgcaacgccggcgccagccagcagccactgtcgctgctgatgatggacatcgatcacttc
aagtcattcaacgacacctacggccatctcaccggcgaccaggtgctgcggctcgtcggc
atgacgctgaagcagagcatcaagggccaggacttcaccgcccgctacggcggcgaggaa
ttcgccgtggtgctgccgaacacgccgatgcgccaggcgatcatcgtcgccgacaacatc
cgccggctggtgatgtcgaaggagctgaagaagaagtcgaccggcgagatcctcggccgg
gtgacgctatcggccggcgtgtcgacgctgaagccgaatgacgatgccgaagcgctgatc
gagcgcgccgacgcctgcctctatgccgccaaacgcaacggccgcaaccgggtgatctgc
gagacagatccggaatttgccggcatcacgcaggccgccgttgcctga

DBGET integrated database retrieval system