KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2988Help
Entry
Rpal_2988         CDS       T00722                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00860  Porphyrin and chlorophyll metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpal_2988
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rpal_2988
Exosome [BR:rpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpal_2988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACF01496
JGI: Rpal2988
UniProt: B3QJJ0
Position
complement(3258666..3259718)
Genome map
AA seq 350 aa AA seqDB search
MAIKFGRPIEIRDPSTRPAAPPLDLTIRPRRNRKTEWARRLVRENVLTTDDLIWPMFVVD
GTNQRVQVASMPGVERLSVDQIVRDAERAAKLDIPCIALFPFTEPSLRDEHGTEAANPEN
LICKTVRAIKKEFPQIGVLCDVALDPYTSHGHDGLIEDGRILNDETVAVLVQQSLVQAQA
GCDVIAPSDMMDGRIGAIREALDAAGYLDVQIMAYAAKYASAFYGPFRDAIGSAKALTGD
KRTYQMDPANTDEAIREVELDLAEGADMVMVKPGMPYLDIVRRVKETFGVPTFAYQVSGE
YAMIAAAANNGWLDGDRAMMESLLAFKRAGANGVLTYFAPAAAEKLRQQG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaattcggccgtcccatcgagattcgtgacccctcgacccggcccgccgct
ccgccgctcgatctcaccatccgtccgcgccgcaaccgcaagaccgagtgggctcgccgt
ctggtgcgcgagaatgtcctcaccaccgacgacctgatctggccgatgttcgtggtcgac
ggcaccaaccagcgggttcaggtcgcctcgatgccgggcgtcgaacgactcagcgtcgac
cagatcgttcgcgacgccgaacgcgccgccaagctcgacatcccgtgcatcgcgctgttc
ccattcaccgagccgtcgctgcgcgacgagcacggcaccgaagccgccaacccggaaaac
ctgatctgcaagaccgtccgcgcgatcaagaaggaattcccgcagatcggcgtgctgtgc
gacgtcgcgctcgacccctacaccagccacggccatgacggcctgatcgaggacggccgc
atcctcaacgacgagaccgtcgcggtgctggtgcagcagtcgctggtgcaggcgcaggcc
ggctgcgacgtgatcgcaccgtcggacatgatggatggccgcatcggcgcgatccgcgaa
gcgctcgatgccgccggctacctcgacgttcagatcatggcctatgcggccaagtatgcg
tccgccttctacggcccgttccgcgacgcgatcggctcggccaaggcgctcaccggcgac
aagcgcacctaccagatggatccggccaacaccgacgaggcgatccgcgaggtcgagctc
gatctcgccgagggcgccgacatggtcatggtcaagccgggcatgccgtatctcgacatc
gtccgccgcgtgaaggagaccttcggcgtgccgaccttcgcctatcaggtgtcgggcgag
tacgcgatgatcgccgcggcagccaacaatggctggctggacggcgaccgggcgatgatg
gagagcctgctcgccttcaagcgcgccggcgccaacggcgtgctgacctacttcgccccg
gcggcggccgaaaagctgcggcagcagggctaa

DBGET integrated database retrieval system