KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3077Help
Entry
Rpal_3077         CDS       T00722                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rpal_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3322779..3323312
Genome map
AA seq 177 aa AA seqDB search
MAAVTKRKVAGLSAAGAMFAAILFGHWEGMSLVARHLPFDPPGVITVCGGITNYDWPWLK
VGMKFTEHECIKAQADAMQRYGAQVAACVPGLADMPPHRQAALASFAGNLGAGKICNRTD
RYKRNPSIAENLNAGRVREACDAMVKFVYANGTFLQGLLNRRTDAMWGERPWCLRED
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcacgaaacgcaaagttgcaggcctgtcggccgcgggcgctatgttcgca
gcgatcctgttcggccattgggaagggatgagccttgttgctcgccaccttccatttgat
ccgcccggcgtaatcaccgtctgcggcgggatcacgaactacgactggccttggctcaag
gtcggcatgaagttcacagagcacgaatgcatcaaggcgcaggccgacgcgatgcaacgc
tacggcgcccaggttgcggcttgcgttccggggctcgccgatatgccgccgcatcggcaa
gccgcgttggcttccttcgccggcaacctcggtgccggcaagatctgcaatcgcacggat
cgctacaagcgcaacccatccatcgccgaaaacctgaatgccgggcgggttcgggaggcc
tgcgacgcgatggtcaagttcgtctatgcgaatggcaccttcctgcagggtcttctcaac
cgtcgcactgacgcgatgtggggcgagcggccctggtgcttacgggaggactga

DBGET integrated database retrieval system