KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3192Help
Entry
Rpal_3192         CDS       T00722                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rpt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rpt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3438250..3439275)
Genome map
AA seq 341 aa AA seqDB search
MAPRAFITGIAGLSLSDDERGFLRESRPWGFILFKRNVDNPAQVKALADELRGTVGSPDA
PVLIDQEGGRVQRLGPPHWPVYPPGAVFSTLYDIDPEAGLTAARLSARLIADDLAALGIT
VDCLPLADVPITGADAVIGDRAYGTSPDKVAAIARAVTDGLAQGGVLPVLKHIPGHGRAT
ADSHHLLPTVETSREELDRTDFAAFRPLADLPMAMTAHVVFSALDAAQPATTSATIIGRV
IRDSIGFQGLLMSDDVSMNALAGSIAERTRAIVAAGCDVVLHCNGKLDEMRQVVAETPEL
QGRALTRAEAALAARHAPQPFDRAAARAELDALIGRARVGA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcgcgctttcatcaccggtattgccggccttagcctcagcgacgatgagcgc
ggatttctccgcgaatctcgtccctggggcttcattctgttcaagcgcaatgtcgacaac
ccggcgcaagtcaaggcgctcgctgacgaattgcgtggaaccgtcggttccccggacgcg
ccggtcctgatcgatcaggagggtggccgggtgcagcggctcggaccgccgcattggccg
gtgtatccgccgggcgcggtgttctccacgctctacgacatcgatcccgaggccgggttg
accgccgcgcggctgagcgcccgtctgattgcggacgatcttgcagcgctcggcatcacc
gtcgactgcctgccgctggccgacgtgccgatcaccggggccgacgcggtgatcggcgac
cgcgcctacggcaccagcccggacaaggtcgcggcgatcgcccgcgccgttaccgacggc
ctggcgcagggcggcgtgctgccggtgctcaagcacattccaggtcatggccgggccacc
gccgacagccatcatctgctgccgaccgtcgagacctcgcgcgaggaactcgaccgcacc
gacttcgccgcgttccggccgctcgcggatctgccgatggcgatgactgcacatgttgtg
tttagcgcgctcgatgccgcccaacccgcgaccacttctgcgacaatcatcggccgggtg
attcgcgactcgatcgggttccaaggattgctgatgagcgacgacgtctcgatgaacgcg
ctggccggcagcattgccgagcgcacccgcgcgatcgtcgcggcggggtgcgacgtcgtc
ctgcattgcaacggcaagctcgacgagatgcgccaggtggtggccgagactccggagctt
cagggcagggcgctgacacgcgccgaggcggcgctggccgcccgccatgccccacagccg
ttcgaccgcgctgcggcgcgggccgaactcgacgcattgatcggccgcgcaagggtgggc
gcatga

DBGET integrated database retrieval system