KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3192Help
Entry
Rpal_3192         CDS       T00722                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00520  Amino sugar and nucleotide sugar metabolism
rpt01100  Metabolic pathways
rpt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rpal_3192
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Rpal_3192
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rpal_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACF01695
JGI: Rpal3192
UniProt: B3Q6I6
Position
complement(3438250..3439275)
Genome map
AA seq 341 aa AA seqDB search
MAPRAFITGIAGLSLSDDERGFLRESRPWGFILFKRNVDNPAQVKALADELRGTVGSPDA
PVLIDQEGGRVQRLGPPHWPVYPPGAVFSTLYDIDPEAGLTAARLSARLIADDLAALGIT
VDCLPLADVPITGADAVIGDRAYGTSPDKVAAIARAVTDGLAQGGVLPVLKHIPGHGRAT
ADSHHLLPTVETSREELDRTDFAAFRPLADLPMAMTAHVVFSALDAAQPATTSATIIGRV
IRDSIGFQGLLMSDDVSMNALAGSIAERTRAIVAAGCDVVLHCNGKLDEMRQVVAETPEL
QGRALTRAEAALAARHAPQPFDRAAARAELDALIGRARVGA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcgcgctttcatcaccggtattgccggccttagcctcagcgacgatgagcgc
ggatttctccgcgaatctcgtccctggggcttcattctgttcaagcgcaatgtcgacaac
ccggcgcaagtcaaggcgctcgctgacgaattgcgtggaaccgtcggttccccggacgcg
ccggtcctgatcgatcaggagggtggccgggtgcagcggctcggaccgccgcattggccg
gtgtatccgccgggcgcggtgttctccacgctctacgacatcgatcccgaggccgggttg
accgccgcgcggctgagcgcccgtctgattgcggacgatcttgcagcgctcggcatcacc
gtcgactgcctgccgctggccgacgtgccgatcaccggggccgacgcggtgatcggcgac
cgcgcctacggcaccagcccggacaaggtcgcggcgatcgcccgcgccgttaccgacggc
ctggcgcagggcggcgtgctgccggtgctcaagcacattccaggtcatggccgggccacc
gccgacagccatcatctgctgccgaccgtcgagacctcgcgcgaggaactcgaccgcacc
gacttcgccgcgttccggccgctcgcggatctgccgatggcgatgactgcacatgttgtg
tttagcgcgctcgatgccgcccaacccgcgaccacttctgcgacaatcatcggccgggtg
attcgcgactcgatcgggttccaaggattgctgatgagcgacgacgtctcgatgaacgcg
ctggccggcagcattgccgagcgcacccgcgcgatcgtcgcggcggggtgcgacgtcgtc
ctgcattgcaacggcaagctcgacgagatgcgccaggtggtggccgagactccggagctt
cagggcagggcgctgacacgcgccgaggcggcgctggccgcccgccatgccccacagccg
ttcgaccgcgctgcggcgcgggccgaactcgacgcattgatcggccgcgcaagggtgggc
gcatga

DBGET integrated database retrieval system