KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3206Help
Entry
Rpal_3206         CDS       T00722                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00020  Citrate cycle (TCA cycle)
rpt00620  Pyruvate metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
Module
rpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_3206
   00020 Citrate cycle (TCA cycle)
    Rpal_3206
   00620 Pyruvate metabolism
    Rpal_3206
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rpal_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H ATP-synt_ab_Xtn QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACF01709
JGI: Rpal3206
UniProt: B3Q6K0
Position
complement(3453317..3454723)
Genome map
AA seq 468 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAADEGTLAKII
VPEGTQDVPVNDVIAVLAADGEDVKAAGAGWKASAGGASSPQPSPQREEGAGPAGGKAEA
NSHIQDKADQRPTPQPPSPLPNGDRSPPQAAGEGAPAPANGRVFASPLARRLAKDAGIDI
ARVTGTGPHGRVIARDVEQAKSGGGLKAAAAAPAAGPAIAPAMSDQQIRALYPEGSYEVV
PHDGMRRTIAQRLTQSTQTIPHFYLTIDCNLDRLMAAREDINAAAPKDKDGKPAYKLSVN
DFIIKAMAIALQRIPDANVSWTEGGMLKHKHSDIGVAVAMPGGLITPIIRSAETQSLSSI
SAQMKDFAARARARKLKPEEYQGGTTAVSNLGMFGIKDFTAVINPPHATILAVGTGEQRP
IARDGKIEIATMMSVTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacattctgatgcccgcgctgtcgccgaccatggagaagggcaaccttgcg
aagtggctgaagaaggagggcgacaaggtcaagagcggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgccgacgaggggacgctcgccaagatcatc
gtgcccgaaggcacccaggacgtgccggtcaacgacgtgatcgcggtgctggctgcggac
ggcgaggacgtcaaggccgcgggggcaggctggaaggccagtgccggcggtgcctcctca
ccccagccctctccccagagggaagagggagccggccccgcgggcggcaaggccgaggcc
aattcgcacatacaggacaaggctgaccaaaggccgacgccacagccgccttcacctctc
cctaacggggacaggtcgccgccgcaggcggcgggtgagggggctccagcgccggcgaat
ggccgcgtgttcgcttcgcccttggcgcggcggctggcgaaggatgccggcatcgatatc
gcccgggtcaccggcaccggaccgcacggccgcgtcattgcccgcgacgtcgagcaggcc
aagagcggtggcggcctgaaggcagcggctgcggcgcctgcggccggtcccgcgatcgcg
ccggcgatgtcggatcagcagatccgcgcgctgtatccggaaggctcctatgaagtcgtg
ccgcacgacggcatgcgccggaccattgcgcaaaggttgacgcagtcgacccagaccatc
ccgcatttctatctgacgatcgactgcaacctcgatcgcctgatggccgcgcgcgaggac
atcaacgccgccgcgccgaaggacaaggacggcaagccggcctacaagctgtcggtcaat
gacttcatcatcaaggcgatggcgatcgccctgcagcgtatccccgacgccaacgtatca
tggaccgaaggcgggatgttgaagcacaagcattccgacatcggcgttgcggtggcgatg
ccgggcggactgatcacgccgatcatccgcagcgccgaaactcagtcgctgtcgtcgatc
tcggcgcagatgaaggattttgccgcacgtgcgcgggcccgcaagctgaagcctgaagag
taccagggcggcaccaccgcggtgtccaatctggggatgttcggaatcaaggacttcacc
gccgtgatcaacccgccgcatgctacgatcctggcggtcggcaccggcgagcagcgcccg
atcgcccgggacggcaagatcgagatcgctaccatgatgagtgtgacgctgagttgcgat
caccgcgccgtcgacggtgcgctcggcgccgaactgatcggcgccttcaagacgctgatc
gaaaatcccgtgatgatgatggtgtga

DBGET integrated database retrieval system