KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3233Help
Entry
Rpal_3233         CDS       T00722                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rpt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpt00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rpt00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rpt00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rpt00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3477778..3478554)
Genome map
AA seq 258 aa AA seqDB search
MPVPAVRPLIAGNWKMNGLKDSVAELDAMLKGAAELPQGIDLLVCPPATLVASFAARVAE
AQAGKALPFSIGGQDCHANASGAHTGDIAAEMLADAGAAAIIVGHSERRADHAENDSIVR
AKAQAVWRAGLVAIVCVGETQGERDAGHTLDVVAGMLAGSLPDGATAANLVVAYEPVWAI
GTGRTPTAADVEEVHGFIRKTLSDRFGAAGETMRILYGGSVKPSNARELLAVPHVNGALI
GGASLKASDFLAIAAGCP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccccgccgttcgtcctctgattgctggaaactggaagatgaacggcctgaag
gattcggtggccgagctcgatgcgatgctgaaaggcgccgcggagctgccgcagggcatt
gatctgttggtctgcccgccggcgacgctggtggcaagcttcgcggcgcgagtcgcggaa
gcccaggccggcaaggcactgccgttctcgatcggcggccaggattgccacgccaacgcc
tctggcgcccacaccggcgatatcgccgccgagatgctggccgatgccggcgctgcggcg
atcatcgtcggccattccgaacgccgcgccgaccatgccgaaaacgactcgatcgtccgc
gccaaggcgcaggcggtgtggcgcgccgggctggtggcgatcgtctgcgtcggcgagact
cagggcgagcgcgacgccggccacaccctcgatgtcgtcgccggcatgctggccggctcg
ctgccggacggcgcgaccgcggcgaatctggtggtggcctacgagccggtctgggcgatc
ggcaccggacgcaccccgaccgcggccgatgtcgaggaagttcatggctttatccgcaag
actttgagcgatcggttcggcgcggcaggcgagacgatgcgaatcctctacggtggctcg
gtgaagccctcgaacgcccgcgaattgctggcagtgccgcacgtcaacggcgcgctgatc
ggcggcgccagcctcaaggcgtccgatttccttgcgattgcggcgggctgcccctaa

DBGET integrated database retrieval system