KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3477Help
Entry
Rpal_3477         CDS       T00722                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00071  Fatty acid degradation
rpt00350  Tyrosine metabolism
rpt00625  Chloroalkane and chloroalkene degradation
rpt00626  Naphthalene degradation
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_3477
  Lipid metabolism
   00071 Fatty acid degradation
    Rpal_3477
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpal_3477
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpal_3477
   00626 Naphthalene degradation
    Rpal_3477
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpal_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: ACF01978
JGI: Rpal3477
UniProt: B3Q9S5
Position
3723794..3724852
Genome map
AA seq 352 aa AA seqDB search
MTQMRRQSLVKFDAPLCETIIDAPKPQGREVLVKIERCGLCHSDLHIQDGYADLGGGKKL
DTTRGMTLPFTLGHEIAGVVAEVGPDAPQDLIGTKKAVFPWIGCGKCRDCLAGDENLCAK
NRFLGVSIDGGFATHVLVPDAKYLLDYDPLPTNVAATLMCSGITAYGALKRLVDRPRQRN
LLLIGLGGVGMMGLSLAQAMFKQPIAVADLSPAAREAALKNGAAVAYDPSEPDVAKRIFK
ETDGGFDGVVDFAGNDKSMNFAVSTVARGGKIVVSGLMGGQFSLPMVQWIYKRMTVEGFM
VGTLEETKELLALARAGKVKPTPMKEEPMQDAQKWIDQLRAGKVVGRIMLAN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatgcgtcgccagtctctggtgaaattcgacgccccgctttgtgagaccatc
atcgatgcgccgaagccgcaggggcgcgaagtgctggtgaagatcgagcgctgcggcctg
tgccactccgacctgcacattcaggacggctacgccgatctcggcggcggcaagaagctc
gataccacgcgcggcatgacgctgccgttcaccctgggtcatgagatcgccggcgtcgtc
gccgaagtcggtcccgacgctccgcaggatctgatcgggaccaagaaagcggtgtttcct
tggatcggctgcggcaaatgccgtgattgcctcgcgggcgacgagaacctgtgcgccaag
aaccgcttcctcggcgtctcgatcgacggcggcttcgcgacccacgtactggtgccggac
gccaagtatctgctcgactacgatccgctgccgaccaacgtcgctgcgacgttgatgtgc
tctggtatcaccgcctatggcgccttgaagcgtctggtggaccggcctcgtcagcgcaat
ctgctgctgatcggtctaggcggcgtcggcatgatgggtctctcgcttgctcaggcgatg
ttcaagcagccgatcgcggtggccgatctcagccccgcggcgcgcgaagcggcgctgaag
aacggcgcggccgtcgcttacgatccatcggagcccgacgttgccaagcgcatcttcaag
gagaccgatggcggcttcgatggcgtggtggatttcgccggcaacgataagtcgatgaac
ttcgccgtcagcacggttgcgcgtggtggcaagatcgtggtgtcgggtctgatgggcggc
cagttcagcctgccgatggtgcaatggatctacaagcgcatgaccgtcgaaggcttcatg
gtcggcacgctcgaagagaccaaggagctgctcgcgctcgcgcgtgccggcaaggtcaag
ccgactccgatgaaggaagagccgatgcaggatgcgcaaaagtggatcgatcagctgcgt
gccggcaaggtcgttggccgcatcatgctggcgaactaa

DBGET integrated database retrieval system