KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3527Help
Entry
Rpal_3527         CDS       T00722                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00240  Pyrimidine metabolism
rpt00250  Alanine, aspartate and glutamate metabolism
rpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpal_3527
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpal_3527
Enzymes [BR:rpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rpal_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACF02027
JGI: Rpal3527
UniProt: B3Q9X4
Position
3774175..3775128
Genome map
AA seq 317 aa AA seqDB search
MTPAPKSTFVLGHRHLLGIEGLSAADISGLLDLSEEYVELNRQVDKKRTSLRGRTQVNLF
FEASTRTQSSFEIAGKRLGADVMNMSVSSSSMRKGETLMDTAVTLNAMHPDILVVRHHAS
GAVELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRLEGLVVAICGDVMHSRVAR
SNILLLNTMGARVRVVAPSTLLPAGIERMGVEVARDMREGLDGADIVMMLRLQRERMNGS
FVPSSAEYFNYFGLDQKKLSYAKPDALVMHPGPMNRGVEIDSIVADGAQSVIREQVEMGV
AVRMAVLEALARNLPNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccccaaaatcgactttcgtcctcggtcaccggcatctgctgggaatcgaa
gggctttccgccgccgacatctccggcctgctcgacctctccgaggagtatgtcgagctc
aaccggcaggtcgacaaaaagcgcaccagtttgcgcggccgcacccaggtcaatctgttc
ttcgaggcgtcgacccggacgcagtcgtcgttcgagatcgccggcaaacgcctcggcgcc
gacgtgatgaacatgagcgtgtcatcatcgtcgatgcgcaagggcgagaccctgatggac
accgcggtgacgctgaacgcgatgcacccggacatcctggtggtccggcatcatgcctcc
ggcgccgtggaactgctcgcccgcaaggtcgacggctcggtgatcaacgccggcgatggc
gcccacgagcatccgacccaggcgctgctcgacgcgctgacgatccgccgcaacaaagga
cggctcgaagggctggtggtggcgatctgcggtgacgtgatgcattcgcgcgtcgcccgc
tccaacatcctgctgctgaacaccatgggcgcccgcgtccgcgtcgtcgctccctccacg
ctgctgccggccgggatcgagcggatgggcgtcgaggtggcgcgcgacatgcgcgaaggg
ctcgacggcgccgacatcgtgatgatgctgcggctgcagcgcgagcgcatgaacggctcg
ttcgtgccctcctcggccgagtacttcaactatttcgggctcgaccagaagaagctgtcc
tacgccaagccggacgcgctggtgatgcacccgggcccgatgaaccgcggtgtcgagatc
gactcgatcgtcgccgacggcgcgcagtcggtgatccgcgaacaagtggaaatgggcgtg
gcggtgcggatggcggtgctcgaagcgctcgcccgcaacctgccgaacgcctga

DBGET integrated database retrieval system