KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3739Help
Entry
Rpal_3739         CDS       T00722                                 

Definition
CheR-type MCP methyltransferase (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_3739
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rpal_3739
Enzymes [BR:rpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Rpal_3739
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rpal_3739
Two-component system [BR:rpt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rpal_3739
Bacterial motility proteins [BR:rpt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rpal_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4002282..4005419
Genome map
AA seq 1045 aa AA seqDB search
MSVGKSGQETGASMVSPRRRPPSLVVGIGASAGGLAAFKTFFDNMPADTGMAFVLVQHLD
PDHKSLLVELRPHSAMPVVEAQDHDPLAPNQVYVIPPNATLSLEGDVLRVATPSPAREYR
RPIDTFFASLAESQEDCAVGIILSGVGSDGSLGIKAIKEHGGFTLAQAEFDDTAMTGMPS
SAAATGLVDRVASVESLPTKLLEHQAYLTKVEEQKGADGAREDVRGSLSAITAVLRRRLK
HDFSGYKQNTLIRRIQRRMQVLQIESVTAYAEHLRKEPSEGDALFRELLIGVTQFFRDED
AFDSLKANFLPSLFTGRDADDPIRVWVAGCATGEEAYSIAIMLQELLGSHQHEAAVTIFA
TDIDPQAVAFARAARFRRIDGLSQERLQRWFVKDGDDYVPTHVIREMCVFSEHNLVRDPP
FSRIDLITCRNVLIYMENDFQHRVMQTFHYALRPGGYLFIGPSESISRETGLFSIVDKKH
RILQRRDGARASLPHFVPQAGAISSPQLPANRIEDQIDKSARRVMAKHSPAYFIIDRNHN
IVRFSGGETGRYLEPSEGNASLDLFANLARSLRTQVRRAVETAFSSGRAVEEENLRLEGK
PPVDLVVEPIIEVGHPPSLVVVAFRTSPHTTDLPQETEISPANRRELEAIQQEFRALQIQ
HRATSEELESQIENMKSVTEEFQSVNEELQSSNEELETAKEEMQSVNEELQTINSELHGK
NELLLQANNDLQNLLDNTQIATIFLDDDLTVRNFTPAAREVFSLRDGDRGRPVTEITSLL
SYDKLCEDVRTVQRTLGVVESQLDLKDESATYIMRIRPYRTVANVISGVVITFSNITEQK
QQHDHLQVLMGELQHRTNNVFAVILAIARQTVRNSASLETFEQQFGARLLALAQANALLV
DQEWKGVSLEKLIEAQLAPFIGGDSTRLELVGPTVTMAGATIQTIGLALHELATNASKYG
SLSVPGGKVVVSWSFDEGGTSPESFRLEWREQDGPPVKPSDRKGFGHFVTKQMVTRSLNA
KVDVDLAPEGLRWSMQMPANEARSG
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgggaagtcaggccaagagaccggtgcgtctatggtttcgccccgtcggcgc
ccgccttccctggtggtcggcattggtgcatcggcgggcgggctcgccgccttcaagacg
ttctttgacaatatgccggccgacaccggtatggcgttcgtgctggttcagcacctcgat
cccgatcacaagagtctgctggtcgagctgcgaccgcattcggccatgccggtggtcgag
gcgcaggaccacgatcctctggcgcccaaccaagtttatgtgatcccgcccaatgcaacg
ctgtctctcgagggagacgttctacgcgttgcgacgccctcgcccgcgcgggagtatcgt
cgtccgatcgacacgttcttcgcgtcgctcgcggagagccaggaggattgcgcagtcggc
atcatcctgtccggtgtcggcagcgacgggtcgctcggcatcaaggccatcaaggaacat
ggcgggtttacgctggcgcaggcggagttcgacgataccgcaatgacgggaatgccgagc
agtgccgcggccacgggactggtcgatcgcgtcgcctcggtcgagagcctgccgaccaaa
ttgctcgagcatcaagcctatctgaccaaggtcgaggagcagaaaggggcagatggcgca
cgcgaggacgtccgcggcagcttgagcgccattacggcggtgctgcgcagacggctcaag
cacgatttcagcggctacaagcaaaacaccctcatccgccgaattcagcgccggatgcag
gttcttcagatcgagtcggtcaccgcttatgcagagcatctgcgcaaggagccttccgaa
ggcgacgcgctgtttcgcgagctgctgatcggcgtcacccagttcttccgcgacgaagac
gcattcgactccctgaaggccaatttcctgccgtcgctgttcaccgggcgagatgcggac
gatccgatccgggtctgggtggcaggctgcgccaccggcgaggaagcgtattcgattgcg
atcatgctgcaggaactcctcggctcccatcaacacgaggctgctgtcaccattttcgcc
accgatatcgatccgcaggccgtcgcgttcgcccgcgccgcgcggttccgccgaattgac
ggcctatcgcaggagcggcttcaacgctggttcgtgaaagacggcgacgactacgttccg
actcatgtcatccgggagatgtgcgttttctccgagcacaatctggtcagagatcctccg
ttctccaggatcgacctgattacatgccgcaacgtcctgatctatatggagaacgatttt
cagcaccgggtgatgcagacgttccattatgcactgcggcccggcggctatctgttcatc
ggtccatccgaaagcatcagccgcgaaacaggattgttcagcatcgtcgacaaaaagcac
cgcatcctgcaacgccgagacggcgccagagcctcgctgccgcacttcgtgccgcaggca
ggggccatttcatctccccaactgccggccaaccggatcgaagaccaaatcgacaagagc
gcgcgccgcgtcatggcgaagcactctccggcttatttcattatcgatcgcaaccacaac
atcgtccggttttccggcggcgagaccgggcgctatctcgagccttcggaaggcaacgcc
agcctcgacctgttcgccaatctggccagaagcctcagaacgcaggtccgtcgcgctgtc
gagaccgccttctcgtcggggcgcgcggttgaagaagaaaacctgagactcgaaggcaag
ccgccggtcgacctcgtcgtcgaaccgattatcgaggtcggacatccgccgagcttggta
gtggtcgccttccgaaccagccctcatacaaccgacctgccgcaagagaccgagatatcg
ccggcgaaccggcgcgagctcgaggcgattcagcaggaatttcgcgccttacagatccaa
catcgggcgaccagcgaggaactggaaagccagatcgaaaatatgaaatcggtgaccgag
gagttccagtcggtcaacgaggagcttcaatcgtccaatgaggagctcgagaccgccaag
gaggagatgcagtcggtcaacgaggaactgcaaaccatcaacagcgaactgcacggcaag
aacgagctgctgctgcaggccaacaacgatcttcagaacctgctcgacaacacgcagatc
gccaccatctttctcgacgacgatctcacggtccgaaacttcacgccggcggcgcgcgaa
gtgttttcgctgcgcgatggcgaccgcggccggccggtgacggagatcacctccctgctg
tcctacgacaagctgtgcgaagacgtcaggaccgtgcaacgcaccctcggtgtcgtggaa
agccagctcgatctcaaggacgagagcgcgacctatattatgcggatcaggccctaccgc
acggtcgccaacgtcatctcgggagtcgtgatcacgttcagcaacatcacagagcagaag
cagcagcacgaccaccttcaagtcttgatgggggagctccagcatcgcaccaacaacgtc
tttgcggtcattcttgcgatcgcacgacagacagtgcgcaacagcgcatcgttggaaaca
ttcgaacagcaattcggcgcgcgactgctggcgctggcgcaagccaacgcgctgctcgtc
gaccaggagtggaagggcgtttcactggagaaactgatcgaagcgcagctggcgccgttt
atcggtggcgactccactcggctcgagttggtcggccccaccgtgacgatggccggcgcc
accatccagacgatcgggctcgcgctgcacgagcttgcgaccaatgcatccaaatacggc
tcactatcggtgccgggcggcaaggtggtcgtaagctggagcttcgacgagggcggaacg
tcccccgagtccttccgactggagtggcgagaacaggatggtccgccggtcaagccgagc
gaccgcaaaggcttcggtcacttcgtcacaaagcagatggtcacgcgctcactcaacgcg
aaggtggacgtcgacctcgctcccgaaggactgcgatggagcatgcagatgccggcgaat
gaagcgcgcagcggatag

DBGET integrated database retrieval system