KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4006Help
Entry
Rpal_4006         CDS       T00722                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpal_4006
   00670 One carbon pool by folate
    Rpal_4006
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Rpal_4006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4293319..4293861)
Genome map
AA seq 180 aa AA seqDB search
MISNAAEMSDVAIVLVVAVADNGVIGQGNAIPWRLKSDLQRFKQLTLNKPVIMGRKTYQS
IGRPLPGRTNIVITRDAAFTAPGVVVAPSFAAAEQVARGDALRRFATEIAVIGGAEIYAQ
WLPLAARIELTEVHAQPAGDTSFPPIDPELWREVARERHTAGPHDSADFSYVTYRRDAAC
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcaacgccgccgagatgtccgacgtcgcgatcgtcctggtcgtcgccgtggcc
gacaatggcgtgattgggcagggcaatgccatcccgtggcggctgaagtcggatctgcag
cggttcaaacagctcacgctgaacaagccggtgatcatgggccgcaagacctatcagtcg
atcggacggccgttgcccggacgtaccaatatcgtgatcacgcgcgatgccgcattcacg
gcgccgggtgtggtggtggcgccgtcgtttgcggcggccgaacaggtcgcgcgcggcgat
gcgctgcggcgatttgccaccgagatcgcggtgatcggcggggccgagatctacgcgcag
tggctgccgctcgccgccaggatcgaactcaccgaagtccacgcacagcctgccggtgat
acctcgtttccaccgatcgatccggaactatggcgggaggtcgcacgtgagcgtcacacg
gccgggccgcatgacagcgctgatttctcctatgtgacctatcgacgcgacgcggcttgc
tga

DBGET integrated database retrieval system