KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4006Help
Entry
Rpal_4006         CDS       T00722                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rpt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4293319..4293861)
Genome map
AA seq 180 aa AA seqDB search
MISNAAEMSDVAIVLVVAVADNGVIGQGNAIPWRLKSDLQRFKQLTLNKPVIMGRKTYQS
IGRPLPGRTNIVITRDAAFTAPGVVVAPSFAAAEQVARGDALRRFATEIAVIGGAEIYAQ
WLPLAARIELTEVHAQPAGDTSFPPIDPELWREVARERHTAGPHDSADFSYVTYRRDAAC
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcaacgccgccgagatgtccgacgtcgcgatcgtcctggtcgtcgccgtggcc
gacaatggcgtgattgggcagggcaatgccatcccgtggcggctgaagtcggatctgcag
cggttcaaacagctcacgctgaacaagccggtgatcatgggccgcaagacctatcagtcg
atcggacggccgttgcccggacgtaccaatatcgtgatcacgcgcgatgccgcattcacg
gcgccgggtgtggtggtggcgccgtcgtttgcggcggccgaacaggtcgcgcgcggcgat
gcgctgcggcgatttgccaccgagatcgcggtgatcggcggggccgagatctacgcgcag
tggctgccgctcgccgccaggatcgaactcaccgaagtccacgcacagcctgccggtgat
acctcgtttccaccgatcgatccggaactatggcgggaggtcgcacgtgagcgtcacacg
gccgggccgcatgacagcgctgatttctcctatgtgacctatcgacgcgacgcggcttgc
tga

DBGET integrated database retrieval system