KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4148Help
Entry
Rpal_4148         CDS       T00722                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rpt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rpt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4441509..4441985)
Genome map
AA seq 158 aa AA seqDB search
MASIYDFTAKSLAGKDVALKEFEGKVLLIVNTASACGFTPQYKGLEALQETYGPRGFSVL
GFPCNQFGAQEPGDEALIAQFCSTNYGVTFPMFAKIDVNGAGAHPLYKFLKDEKGGLLGS
AIKWNFTKFLVDRSGRVVSRHAPTTTPEALSKEIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatctatgatttcaccgccaaatcgctggcgggcaaagatgtcgcgctgaaa
gagttcgaaggaaaggtgctgctgatcgtcaacaccgcgagcgcctgcggcttcaccccg
caatacaagggcctcgaagcgctgcaggagacatatggcccgcgcggcttttcggtgctc
ggctttccgtgcaaccagttcggtgcgcaggagcccggcgacgaagcgctgatcgcgcag
ttctgttcgaccaattacggcgtgaccttcccgatgttcgccaagatcgacgtcaatggc
gccggcgcgcatccgctgtacaagtttctgaaggatgaaaagggcggcttgctcggctcg
gcgatcaaatggaatttcaccaagttcctggtcgatcggtccgggcgcgtggtatcgcgg
catgcgccgaccaccacgccggaggcgctttcgaaagagatcgagaccttgctatga

DBGET integrated database retrieval system