KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4162Help
Entry
Rpal_4162         CDS       T00722                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpal_4162
Enzymes [BR:rpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rpal_4162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4456746..4458698)
Genome map
AA seq 650 aa AA seqDB search
MDLFTKAAELGIQTEFYDGQGCRHVTPPEALALIIEAMPEAAVRPLLDRIVVIRQGEECR
SDLDAQAALPVRWQIVAGEATLAEGTADARNVTWPQGLPSGTHRLRLSDASGRTEEVPLL
VAPPHAFNGEFDRSWLIAVQLYSLRSARNWGIGDFTDLSQLIELAAALGAGGVGLNPLHA
LFDDRPNDCSPYSPNSRMFLNPLYIDVERLPEFSLSDLPGVDIAALRDGELIDYNVVATM
KWRALRAAFDKFCDAPGPGRREAFEAFRSERAPLLTRFACFEVLRHKFGTPWWDWTDEWR
RPDDVRCARLREGPDGRAVEFIEFAQWCADEQLRACQALAAERGMRVGLYLDVAVGVQSD
GFDAWNEQTAISRVLSVGAPPDSLNTAGQNWGLAGFNAPGLELTGFAPFREMLRASMRYA
GAIRLDHVLGLNRLYLVPHGFAANQGVYVRMPFEALLAVTAQESVDQRCVVIGEDLGTVP
DGFREQLAAWGVWSYRVMMFERDFHQGWFFGLDHYLPNALVTFNTHDLATYSGWRASTDL
HLKRSIGVDPGESDDSRRHALVMLGDALRHQGIEQDDIYAVLTFLARTPSRLLAIALEDL
LGVLDQPNVPGTVSEHPNWRRRLPKAIEDIAAVINRQALLAATADRRIAG
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatttattcaccaaagctgccgagttgggcatccagaccgaattttatgacggtcag
gggtgtcgccatgtcacgccgccggaagcgttggcgctgattatcgaggccatgcccgaa
gctgcggtgcggccgttgctggaccggatcgtggtgatccggcagggcgaggaatgccgc
tccgatctggacgcgcaggcggcgttgccggtgcgctggcagatcgttgctggtgaagcg
acgctggcggaaggcaccgctgacgcgcgcaacgtcacctggccgcaggggctgccgagc
ggtactcaccggttgcggctcagcgacgcatccgggcgcaccgaggaggtgccgcttttg
gtcgcgccgccgcatgccttcaacggcgagttcgaccgctcctggctgatcgccgtgcag
ctgtacagcctgcgctccgcgcgcaactggggcatcggcgacttcaccgatctgtcgcag
ttgatcgagctggcggccgcgctcggcgccggcggcgtcggcctcaatccgctgcacgcg
ctgttcgacgaccgccccaatgattgcagcccgtattcgccgaacagccggatgtttctc
aatccgctttacatcgatgtcgagcgattgccggaattctcgctgagcgacctgccgggt
gtcgatatcgcggcgctgcgcgacggcgaactgatcgactacaacgtggtggcgacgatg
aagtggcgtgccttgcgcgccgctttcgacaaattctgcgacgcgcctgggccgggacgg
cgcgaggcgttcgaggcgttccgctccgagcgcgcgccgctgctgacgcgattcgcgtgt
ttcgaagtgctccggcacaaattcgggacgccgtggtgggactggaccgacgagtggcgg
cggcccgacgacgtgcgctgcgcccgcctgcgcgaggggccggacggccgcgcggtcgag
ttcatcgaatttgcgcaatggtgcgccgatgaacaattgcgcgcgtgccaggctctcgcc
gccgaacgcggcatgcgcgtcgggctgtatctcgacgtcgcggtgggagtgcagagcgac
ggcttcgacgcctggaacgaacagacggcgatctcgcgcgtgctgtcggtcggcgcgccg
ccggattcgctcaacaccgctggtcagaattggggacttgccgggttcaacgcgccgggg
ctggagctgaccgggttcgcgccgttccgcgagatgctgcgcgcatcgatgcgctatgcc
ggtgcgatccggctcgatcacgtgctcgggctcaaccggctgtatctggtcccgcacggt
ttcgccgccaatcagggcgtctatgtgcgaatgccgttcgaggcgctgctcgcggtcacc
gcgcaggagagcgtcgatcagcgctgcgtggtgatcggcgaggatctcggcacggtgccc
gacggcttccgcgaacagctcgcggcctggggcgtctggtcgtatcgcgtgatgatgttc
gagcgcgactttcaccagggctggttcttcggcctcgatcattatctgccgaacgcgctg
gtcaccttcaacacccatgacctcgcgacctattcgggctggcgtgcgtcgaccgatctg
catctgaagcggtcgatcggcgtcgatcccggcgagagcgacgattcccgccgccacgct
ttggtgatgctcggcgatgcgctgcgccatcagggcatcgagcaggacgacatctacgcg
gtgctgacgttcctggcgcgcacgccgtcgcggctgctggcgatcgcgctggaagatctg
ctgggcgtgctcgatcaacccaacgtgcccggcacggtgtcggaacatccgaactggcgg
cgcaggctgccgaaggcgatcgaagacatcgccgcggtgatcaatcgccaagcgctgctc
gcggcgaccgccgaccgccgcatcgcggggtga

DBGET integrated database retrieval system