KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4165Help
Entry
Rpal_4165         CDS       T00722                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4464172..4466322
Genome map
AA seq 716 aa AA seqDB search
MTVQLSDEAYAVVEGRHADPFRYLGAHPEDGATMVRVLLPDAVAVEVIGDNGHVAPLDQA
HPAGLFVGPLPGASPRYTLRARFGDTTVELQDPYRFPPILSDFDLYLLGEGSDQRLYDKL
GAHPMELEGVAGVGFVVLAPNARRVSVVGDFNFWNPLRHQMRVRGNGYWELFVPGARAGD
HYKFDLAGPNGEQLPQKADPLAFAAELRPKTASIVVDATTLSRPRPAPENINALSAPMSI
YEVHLGSWRRKEGDQWLTYRELAEQLPAYVRDMGFTHVEFLPVSEHPFDGSWGYQPTGLY
APTSRFGSPEDFCALVDACHAAGIGVILDWVPGHFPDDPHGLGNFDGTALYEHANPMQGR
HLDWGTLIYNYGRTEVVNFLTANALFWLERYGIDGLRVDAVASMLYLDYSRPAGGWIPNK
FGGRENIEAIDFIRRFNTEVYGKFPHATTAAEESTAWPQVSRPIEFGGLGFGYKWNMGWM
HDTLNYISKDPIHRKYHHGQILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDEWQR
FANLRAYYAFMFGHPGKKLLFMGSEFGQEREWSHDRSLDWHLLEYPKYSGIQALLRDLNK
LYRSLPALHQLDCDPFGFEWLITEDANRNVFAWMRKGNDTRARCLVIVNFSPNVYQDYRV
RVPFPGRWREVFNSDSAGYGGSNVGNGGEVRTLEGLVPELSLTIPPLAAIFLTPED
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaattgagcgacgaagcctacgcagttgtcgaaggccgtcatgccgatcca
ttccgctatctcggcgcacaccctgaggatggcgccaccatggtgcgcgtgctgctgccg
gatgccgttgcggtcgaggtgatcggcgacaatggccacgtcgcgccgctcgaccaggcg
catccggccggcctgttcgtcggacctctgcccggcgcttcgccgcgctacacgttgcgc
gcacggttcggcgacaccacggtcgagctgcaggacccctaccgcttcccgccgatcctc
agcgatttcgatctttacctgctcggcgaaggctccgaccagcggctttacgacaagctt
ggcgcccatccgatggagctggaaggtgtcgccggcgtcggtttcgtggtgctggcgccg
aacgcgcgccgcgtcagcgtggtcggcgatttcaatttttggaatccgctgcgccaccag
atgcgggtgcgcggcaacggctattgggagctgtttgtcccgggcgcccgagccggcgat
cactacaagttcgatctcgccggaccgaacggcgaacaactgccgcagaaggccgacccg
ttggcattcgccgccgagctgcggccgaagaccgcctcgatcgtggtcgacgccaccaca
ctgtcgcgaccgcggccggcgccggagaacatcaacgcgctgtcggcgccgatgtcgatc
tacgaggtgcatctcggctcgtggcgccgcaaggaaggcgaccagtggctgacctatcgc
gaactcgccgagcaactgccggcctatgtccgcgacatgggctttacccacgtcgaattc
ctgccggtcagcgagcatccgttcgacggctcgtggggctatcagccgaccggcctgtac
gcgccgacctcacgcttcggctcgcctgaggatttctgcgcgctggtcgacgcctgccat
gccgcgggcatcggcgtgatcctcgactgggtgccgggccatttcccggacgatccgcac
ggcctcggcaatttcgacggcacagcgctgtacgagcacgccaacccgatgcaagggcgg
catctcgactggggcacgctgatctacaattacgggcgaaccgaggtcgtcaatttcctc
accgcgaacgcgctgttctggctggagcgttacggcatcgacgggctgcgcgtcgatgcg
gtggcctcgatgctgtacctcgattacagccgcccggccggcggctggatcccgaacaaa
ttcggcggccgtgagaacatcgaggcgatcgacttcattcgccgcttcaacactgaagtg
tacggcaaattcccgcacgccaccaccgcagcggaggaatccaccgcctggccgcaggtg
tcgcgcccgatcgaattcggcgggctcggattcggctacaagtggaacatggggtggatg
cacgatacgctgaactacatcagcaaggatccgattcaccgcaaatatcatcacggccag
atcctgttcggactgcactacgcgttctcggagaatttcattctgccgctgtcgcacgac
gaggtcgttcacggcaaacgctcgatcctcggccggatgccgggcgatgagtggcaacgc
tttgcgaatctacgcgcctactatgcgttcatgttcgggcaccccggcaagaagctgctg
ttcatgggcagcgagttcggccaggagcgcgaatggagccacgatcgctcgctcgactgg
catctgctggaatatccgaaatattccggcatccaggcgttgctgcgcgacctcaacaag
ctgtacaggtcgctgccggcgctgcatcagctggattgcgatccgttcggcttcgaatgg
ctgatcaccgaagacgccaatcgcaacgtgttcgcctggatgcgcaagggcaacgatacc
cgcgcccgctgtctggtgatcgtcaacttctcaccgaacgtctaccaggactatcgcgtc
cgcgtgccgttccccggtcgctggcgcgaagtgttcaattcggactcggccggctacggc
ggcagcaatgtcggcaatggcggcgaagtccgcaccctggagggtctggtgcctgagctg
agcctgacgatcccgccgctggccgcgatcttcctgacgccggaggattga

DBGET integrated database retrieval system