KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4176Help
Entry
Rpal_4176         CDS       T00722                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rpal_4176
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_4176
  Lipid metabolism
   00071 Fatty acid degradation
    Rpal_4176
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpal_4176
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpal_4176
   00626 Naphthalene degradation
    Rpal_4176
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpal_4176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4479937..4480989)
Genome map
AA seq 350 aa AA seqDB search
MRSFRVTDFGKPLSEDNRPTPELTGTQVLVRVKAAGICHSDLHIWEGGYELGHGRKKLSL
ADRGVALPLTMGHETVGEIVAAGPNAKDAKIGQVALVYPWIGCGECDVCKAGDENMCLKP
RFLGVYCDGGYSDELIVPHPRYLLSLDGLDPVTAAPYACSGITTYSALKKLDFCLDSPIV
IFGAGGLGLMALELLKAMGGKGAIMVDIDAAKRDAAQKAGALGTVDGAAPDALAQIAAIA
KGPVRGALDLVGNPQTAQLGFDCLTKGGKLVIVGLFGGGAPWALPFIPMRAITIQGSYVG
NLAETQELLDLVRAKKVSPIPVTKVALPQAYDALIDLQKGKLVGRAVLTP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctttcgcgtcactgatttcggcaagccgctgagcgaagacaaccggccgacg
ccggaactgaccggcacgcaagtgctggtccgcgtcaaggccgccggcatctgccatagc
gatctgcacatctgggaaggcggttacgaactcggccacggccgcaagaagttgtcgctc
gccgatcgcggcgtcgcattgccgctgacgatgggccacgagaccgtcggcgagatcgtc
gccgctggtcccaacgccaaggatgccaagatcgggcaggtcgcgctggtgtatccgtgg
atcggctgcggcgaatgcgacgtctgcaaggccggcgacgagaatatgtgcctgaagccg
cggtttctcggcgtgtattgcgacggcggctactcggacgaactgatcgtgccgcatccg
cgctatctgctcagccttgatgggctcgatccggtgaccgcagcgccctatgcgtgctcc
ggcatcaccacctacagcgcgctgaagaagctcgacttctgcctcgacagcccgatcgtg
atcttcggtgccggcggactcggattgatggcgctggagctgctcaaggcgatgggcggc
aagggcgccatcatggtcgatatcgacgcggccaagcgcgatgcggcccaaaaggccggc
gcgcttggcacggtcgatggcgccgcgccggacgcgctggcgcagatcgcggccatcgcc
aaaggtccggtgcgcggtgcgctggatctggtcggcaatccgcagaccgcgcagctcggc
ttcgattgcctcaccaagggcggcaagctggtgatcgtcggtctgttcggcggcggcgca
ccatgggcgctgccgttcatcccgatgcgtgccatcaccatccagggcagctatgtgggt
aatctcgccgaaacccaggaactgctcgaccttgtccgcgccaagaaggtgtcgccgatc
ccggtcactaaggtggcgctgccgcaggcttacgatgcgctcattgatctgcagaagggc
aagctggtcggtcgcgcggtgctgacgccgtag

DBGET integrated database retrieval system