KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4215Help
Entry
Rpal_4215         CDS       T00722                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rpal_4215
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4521109..4521663)
Genome map
AA seq 184 aa AA seqDB search
MDTFELNKIVGAIFGTLLILLLSNFTAQAIFSPTKPEKQGYAIVVKEAEPAQAKDAAPKA
DEPIEKLLQTASVDQGSKVAKKCAACHTFEKDGPNRVGPNLYGIVGDHRGEGRNGFNFSA
AMKAKGGAWTFDELNKFLANPKGYIPGTAMSFAGVPNDKERADLIAYLNKNSDKPEALPA
TAEK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatactttcgaactcaacaaaattgtcggcgcgatcttcgggaccttgctgatcctg
ctgctgtccaatttcaccgcccaggcgatcttctctccgaccaagcctgaaaaacagggc
tatgccatcgtagtgaaggaagccgagccggcgcaggcgaaggatgctgcgccgaaggcg
gacgagccgatcgagaagctgctgcagaccgcctcggtcgatcagggctccaaggtcgcc
aagaagtgcgcggcctgccacaccttcgagaaggacggcccaaaccgcgtcggcccgaac
ctctacggcatcgtcggcgaccatcgcggcgaaggccgaaacggtttcaatttctcggct
gcgatgaaggccaagggcggcgcctggacgttcgacgagctcaacaagttccttgcgaac
ccgaagggctacattccgggcaccgcgatgagcttcgccggcgtcccgaacgacaaggaa
cgggccgacctgatcgcctatctcaacaagaattccgacaagcccgaggcgctgccggcg
acggccgagaagtaa

DBGET integrated database retrieval system