KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4226Help
Entry
Rpal_4226         CDS       T00722                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rpal_4226
Enzymes [BR:rpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rpal_4226
Exosome [BR:rpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpal_4226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4535783..4537285)
Genome map
AA seq 500 aa AA seqDB search
MPFVMAIDQGTTSSRAILFRSDISIAASAQQEFPQHFPASGWVEHEPEDIWATTIATCRA
AMDKAGATAADIAAIGITNQRETVVVWDAVSGQAIHRAIVWQDRRTAEFCTRLKAEGLEP
MVTAKTGLIIDPYFSGTKVAWLLDNVPGARARAERGELKFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHDGAWDDELLKLLGVPRSMLPEVKDSSAHFGDSVPELFGGSITIRGIA
GDQQAATIGQACFTPGMIKSTYGTGCFALLNTGATPVKSNNKLLTTVAYQLGGKRTYALE
GSIFVAGSAVQWLRDGLGVIKHASETGPLADKSDSAQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDADAATTVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLSAGVFPEPQKFADNWRLDHRFRPAMSAATRE
RKLAGWARAVRGLLATDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgtcatggccatcgatcagggcaccacctcgtcgcgggcgattctgtttcgt
tccgacatttcgatcgcggcctccgcgcagcaggaattcccgcagcactttccggcgtcc
ggttgggtcgagcacgagcccgaggacatctgggcgacgaccatcgccacctgtcgcgct
gcgatggacaaggctggcgcgaccgccgccgacatcgccgcgatcggcatcaccaaccag
cgcgaaaccgtggtggtgtgggatgccgtctcaggccaggcgatccaccgcgccatcgtc
tggcaggaccgccgcaccgcggagttctgcacccggctgaaggccgaagggctggagccg
atggtcaccgccaagaccgggctgatcatcgatccgtatttctccggcaccaaggtcgcc
tggctgctcgacaacgtgcccggcgcacgcgctcgcgccgagcgcggcgagctgaaattc
ggtaccgtcgattgctatctgctgtggcggctgaccggcggcaaggtccacgccaccgac
gctaccaacgcctcgcgcaccctgctgttcaacatccacgacggcgcctgggacgacgag
ctgctcaagctgctcggcgtgccgcgctcgatgctgccggaggtgaaggattcctcggcg
catttcggcgacagcgtgccggagctgttcggcggctcgatcaccatccgcggcatcgcc
ggcgaccagcaggcggcgaccatcggccaggcctgcttcaccccgggcatgatcaagtcg
acctacggcaccggctgcttcgcgctgctcaacaccggtgcgacgccggtgaagtcgaac
aacaagctgctgaccaccgtcgcctatcagctcggcggcaagcgcacctatgcgctcgag
ggctcgatcttcgtcgccggaagcgcggtgcaatggctgcgcgacggcctcggcgtcatc
aagcacgcctccgagaccgggccgctcgccgataaatcggattcggcgcagagcgtgtat
ctggtgccggcgttcgtcggcatgggcgcgccgtattggaatccgcgggtccgcggcgcg
ctgttcggcctgacgcgcaacaccggcccggccgaactcgcccacgccgccctggagagc
gtgtgctaccagaccttcgatctgtgggcggcgatgcgtgccgactggccggacgccgac
gccgccaccaccgtgcttcgcgtcgacggcggcatgaccgcctcggactggaccatgcag
cgcctcgcggatctgctcgacgccccggtcgatcgcccggtgatccaggaaaccaccgcg
ctcggcgccgcgtacttggccggcctcagcgcaggcgtcttccccgaaccacaaaaattc
gccgacaactggcgcctcgaccaccgcttccgccccgcgatgagcgccgccacccgcgag
cgcaaattggcgggctgggcgagggcggtgagggggctgctggccacggatgagggggag
tga

DBGET integrated database retrieval system