KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4563Help
Entry
Rpal_4563         CDS       T00722                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4914451..4915296
Genome map
AA seq 281 aa AA seqDB search
MAERLQGTRILILETREEAQFARLLTEQGADVLQCPMFEIRDAPDPAPVSAWIDRLIAAP
FDDLVLLTGEGLRRLTKLARATDRERPFVAAVGRTRTFIRGPKPGRALREIGLEPQVTAE
APTSEGIAATLKRYDLAGRRIGVQLYPERDHAALLDSITAQDATVDAVLPYSYDARAAEQ
TVVTAVEEMAQGRVDALALTSSGQVRRLFDVARAHNREDRLRDGLSRTPIASVGPVVTEE
LAAHGFAPTITPANEAFFMKPLISAMIVALGGRTPRNTAAG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacggctccaaggcacccgtatcctgatcttggagacccgcgaggaggcccag
ttcgcccggctgctgaccgaacagggcgccgacgtcctgcagtgcccgatgttcgaaatc
cgcgatgcgcccgaccccgctccggtctcggcctggatcgaccggctgatcgccgcgccg
ttcgacgatctggtgctgctgaccggcgaggggttgcggcggctgaccaagctggcccga
gcgaccgaccgcgaacggcctttcgtggcggccgtgggccggacgcgaacgttcatccgc
gggcccaagccaggccgagcgttgcgcgagatcgggctggagccgcaggtgactgccgaa
gcaccgacctccgagggcatcgccgccacgctgaaacgctatgatctcgccgggcgccgg
atcggcgttcagctctatcccgaacgtgaccacgccgctttgctcgattccattacggcg
caagacgccaccgtcgatgcggtgctgccttattcctacgacgcgcgtgcggccgaacag
accgtcgtcactgccgtcgaggagatggcgcaaggccgcgtcgatgcgctggcgctgacc
agttccggtcaggtccgacggctgttcgacgtcgcccgcgcgcacaatcgcgaagaccga
ctgcgcgacgggttaagccgcacgccgatcgcctcggtcggtccggtggtgaccgaggaa
cttgccgcgcacggcttcgcgccgaccatcacccccgccaatgaggcattcttcatgaag
ccgctgatcagcgcgatgatcgtcgcactcggcggacgcacgccacgcaacacagcggca
ggttga

DBGET integrated database retrieval system