KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4592Help
Entry
Rpal_4592         CDS       T00722                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpal_4592
Enzymes [BR:rpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rpal_4592
Peptidases [BR:rpt01002]
 Cysteine Peptidases
  Family C44
   Rpal_4592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4949859..4951796
Genome map
AA seq 645 aa AA seqDB search
MCGFAGIYGGSDRAAVEAMVSSMRHRGPDDSGVYVDDRVSLGHARLSIIDLTPGGHQPMF
NAAGTIGIVYNGEIYNYPEERERLIRLGESFRSTSDTEVLLALYEREGDAFLSRLRGIFA
FAIYDRRDGPGRERLLLARDHFGIKPLIYAETPTGLVFASELKALLASGRVDRAVDREAL
RTLLTFGSVTQPHTIIEGARHLPAAHKMVVDASGCRMSPYWSFGVDRVAGLRTSPYPEIR
EHVRDAVIRSVEMQMIGDVTVGAFLSGGVDSSLIVALMAQNSGARIKTYSVGFETGAAAE
DETEDAAEIAARLKTDHTRAVIGGEEAASHLPRFVAGIDQPSVDGMNSYFVSHWASQHVK
VALSGTGGDELFAGYPWFAGMIPDFDARPHSAARQPRRFLGRLRNLLQPAEAPLDDTDYT
ARFLETYGGLYHCFGPVTAAALLSMSSPIAMAADLSGLDALPSADVLDRVGALCLNGYTR
NQLLRDIDCTSMAGSLEVRVPFLDPVIADIALSLPRDAKLRPGGTPLTPAASYDESGVKR
VLIDVAREFLPQSFFSRRGKRGFNLPFGDWMRGPLRPVLDHALSPETVRRRGLFDVAVVD
EIRRQFLDGHRSWNGPWLLMIIELWMQDVFDRPGPYRLPDPRPYA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttgccggaatatacggggggtcggaccgcgcagcggtagaggcgatggtg
tcgtcgatgcggcaccgcgggcccgacgacagcggcgtctatgtcgacgacagggtcagc
ctgggccacgcgcgattgtcgatcatcgacctcacgcccggcggccaccagccgatgttc
aatgcggccggcacgatcgggatcgtctacaacggggaaatctacaattatcccgaagag
cgcgagcggctgatccggctcggagagagcttccggtcgacctcggacaccgaggtgttg
ctggcgctgtacgaacgcgagggcgatgcgttcctgtcccggttgcgcggcatcttcgca
tttgcgatttacgatcggcgagacggtccggggcgtgagcgcctgctgttggcgcgcgac
catttcggcatcaagccgttgatctatgccgaaacgccgaccgggctggtattcgcctcc
gaactgaaggcacttctcgccagcggccgggtggatcgcgcggtagaccgcgaggcgttg
cggactctgctgaccttcggttcggtcacccagccgcataccatcatcgaaggtgcccgt
catttgccggcagcccacaagatggtcgtcgacgcatccggctgccggatgtcaccgtac
tggtcgttcggcgttgaccgggtggcgggcctgcgcaccagcccatatccggagatccgc
gaacacgtgcgcgacgccgtcatccgttcggtggagatgcagatgatcggcgacgtgacc
gtcggcgcgtttctgagcggcggcgtcgactcctcgctgatcgtggcgctgatggcgcag
aacagcggcgcgcggatcaagacctattcggtcgggttcgagaccggcgccgccgccgag
gacgaaacagaagacgccgccgagatcgccgcgcggctgaagaccgaccatacccgggcc
gtgatcggaggagaggaggctgcgtcgcatctgccgagattcgtggccggcatcgaccag
ccatcggtcgacggcatgaacagttacttcgtctcgcactgggcgagccagcacgtgaag
gtggcgctgtccggtaccggcggcgacgagctgttcgccggctatccgtggttcgccggc
atgatccccgatttcgacgcccggccgcactccgccgcgcggcagccgcgcaggtttctc
ggtcgactgagaaatctgctgcagcccgccgaagcgccgctcgacgataccgactacacg
gcacgcttcctggagacctatggcggcctctatcattgcttcgggccggtgacggcggcg
gcgctgctgtcgatgtcgtcgccaatcgcgatggccgcggacctgtccggactggatgct
ctaccctcggccgacgtgctggacagggtcggcgcgctgtgcctcaacggctatacccgc
aatcagctgctgcgcgacatcgactgcacctcgatggccggatcgctggaagtacgcgtg
ccgttcctcgatccagtgatcgcggacatcgcgctgtcgcttccgcgcgacgccaaactc
cggcccggcggaactccgttgacgccagcggcgagctacgacgaaagcggggtcaaacga
gtgctgatcgacgtcgcgcgcgaatttctgccgcagtcgttcttcagccggcgcggcaag
cgcggtttcaacctgccgttcggggactggatgaggggaccgctgcggccggtcctcgac
catgcgctgtcgcccgagacggtgcgccgccgcggcctgttcgacgtcgcggtggtggac
gagatccgccggcaatttctcgacggacaccgctcgtggaacggtccctggctgctgatg
atcatcgaattgtggatgcaggacgtgttcgatcgtccgggcccgtatcgcttgcccgac
cctcgaccgtacgcctga

DBGET integrated database retrieval system