KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4625Help
Entry
Rpal_4625         CDS       T00722                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpal_4625
Enzymes [BR:rpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rpal_4625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4985098..4986642
Genome map
AA seq 514 aa AA seqDB search
MNAPDLTRPPLTIRRISLDTGRENVAVISRRSRALRPEVFRGFSRVELRINSKVLLATLM
ITDDDAMIGPDEVGLSEPAFRRFNEPVGSAVSVTPARSPASLDAVRAKIQGHTLSAAEIT
AIVDDLAHFRYSDMEIAAFLISAARFTTTDELLALVGAMASVGTKLTWDTPIVVDKHCIG
GIPGNRTTMIVVPIVAAHGLMIPKTSSRAITSPAGTADTMELLARVDLDVEQMKQVVHAC
GGCLVWGGHVNLSPADDILISVERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSA
KVTSANEAMRLRKLFEFVGDHFGISVEVVTTDGRQPIGRGIGPVLEARDVMAVLGNKPGA
PADLREKSLRLAAHLLEYDPKLRGGTGYARAKELLDSGAALKKMQQIIDAQGPSPCPAEL
GSYAADVLAAADGVVNGIDCLRINRLARSAGAPVAKGAGIDLFKKIGDRVEKGEPLYRVY
ASDRSEFDLALAAAQAESGFAINHHTPADVDLVS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgctcccgatctcacccgcccgccgctgacgatccggcggatcagcctcgacacc
ggccgcgaaaacgtcgcggtgatttcccgccgctcgcgcgccctgcgccccgaggtgttt
cgcggcttcagccgcgtcgaactgcgcatcaactccaaggtgctgctggcgacgctgatg
atcaccgacgacgacgcgatgatcggccccgacgaagtcggcctgtccgagccggcgttc
cgccgcttcaatgagccggtcggcagtgccgtgtcggtgacgccggcgcggtcgcccgca
agcctcgacgcggtacgcgccaaaatccagggccacacgctatccgcggcggagatcacc
gcgatcgtcgatgacctcgcgcacttccgttactccgacatggaaatcgccgcgttcctg
atcagcgccgcgcgcttcaccacgaccgacgaactgctggcgctggtcggcgcgatggcc
tcggtcgggaccaaactgacatgggacacgccgatcgtcgtcgacaagcactgcatcggc
ggcattcccggcaaccgcaccaccatgatcgtggtgccgatcgtcgccgcgcacgggctg
atgattccgaagacctcgtcgcgcgccatcacctcgccggccggcaccgccgacaccatg
gaactgctggcgcgggtcgatctcgacgtcgagcagatgaagcaggtggtacatgcctgc
gggggctgtttggtgtggggcggccacgtcaacctgtcgcctgccgacgacatcctgata
tcggtcgagcgaccgctcagcctcgacacgccggagcaaatggtcgcctcgatcatgtcg
aagaagctcgccgccggctcgacccggctgctgatcgacttcccggtcggcccgtccgcc
aaggtcacgagcgccaacgaggcgatgcggctgcgcaagctgttcgagttcgtcggcgat
catttcgggatcagcgtcgaagtggtgaccaccgacggccgacagccgatcggccgcggc
atcggcccggtgctggaagcccgcgacgtgatggcggttctgggcaacaagcccggcgca
cccgctgacttgcgcgaaaaatcgctgcggctcgctgcgcatctgcttgaatacgacccg
aagctgcgcggcggcaccggctatgcccgcgccaaggagctgctcgacagcggggctgcg
ctgaagaagatgcagcagatcatcgacgctcaggggccttcgccgtgtccggccgagctc
ggcagctacgccgccgatgtactcgctgcggccgatggcgtggtcaacggcatcgactgt
ctgcgcatcaaccgcctcgcccgcagcgccggcgcgccggtcgccaagggcgccgggatc
gatctgttcaagaagatcggcgaccgcgtcgaaaagggcgagccgctgtatcgggtttat
gcgtccgaccgctccgaattcgatctggcgctggcagccgcacaggcggagtccggcttc
gcgatcaatcatcacacgcccgccgacgtggatctggtgtcgtga

DBGET integrated database retrieval system