KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4634Help
Entry
Rpal_4634         CDS       T00722                                 

Definition
3-oxoacid CoA-transferase subunit B
Orthology
K01029  
3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rpal_4634
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rpal_4634
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpal_4634
Enzymes [BR:rpt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Rpal_4634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4994804..4995454)
Genome map
AA seq 216 aa AA seqDB search
MAWTREQMAARAAKELRDGFYVNLGIGIPTLVSNYIPDGVDVVLQSENGMLGMGPFPYEG
EEDPDLINAGKQTVTELPSTSYFSSADSFAMVRGGHIDLSILGAMQVAQNGDLANWMIPG
KMVKGMGGAMDLVAGVKRVVVVMEHSAKDGPKLLKTCNLPLTGERVVDMVVTDLAVFTID
KHGNDGMALIELADGVTLDEVKAKTEAEFRVALKNA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacccgcgaacagatggccgcgcgcgccgccaaggaattgcgcgacggcttc
tacgtcaacctcggcatcggcattccgacgctggtctccaactacatcccggacggcgtt
gacgtggtgctgcagagcgagaatggcatgctcggcatgggcccgttcccctatgagggt
gaagaagaccccgacctgatcaacgccggcaagcagaccgtcaccgagctgccgtcgacc
agttacttctcgtcggccgattccttcgcgatggttcgcggcggccacatcgacctctcc
attctcggcgccatgcaggtcgcgcagaacggcgacctcgccaactggatgattccgggc
aagatggtgaagggcatgggcggcgcgatggatctcgtcgccggcgtgaagcgcgtcgtc
gtggtgatggagcattccgccaaggacggcccgaagctgttgaagacgtgcaacctgccg
ctcaccggcgaacgcgtcgtcgacatggtggtcaccgacttggccgtgttcaccatcgac
aagcacggcaatgacggcatggcgctgatcgagctcgccgatggcgtcacgctcgatgag
gtcaaggccaagaccgaagccgaattccgcgtcgcgctgaagaacgcttag

DBGET integrated database retrieval system