KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4692Help
Entry
Rpal_4692         CDS       T00722                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00220  Arginine biosynthesis
rpt00250  Alanine, aspartate and glutamate metabolism
rpt00471  D-Glutamine and D-glutamate metabolism
rpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpal_4692
   00220 Arginine biosynthesis
    Rpal_4692
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rpal_4692
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Rpal_4692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACF03183
JGI: Rpal4692
UniProt: B3QKT6
Position
complement(5050519..5051454)
Genome map
AA seq 311 aa AA seqDB search
MSNQLLDRVVAEIADEMAQRADRGEVASYIPQLARVDPKAFGLAVIGADGHIAAAGDADV
PFSIQSISKVFTLTLALGKAGDRLWRRVGREPSGSAFNSIVQLEHERGIPRNPFINAGAI
AVTDLILSGHQPREALGEILRFMQFLAGDSSIAIDEAVAKSEQRTGFRNAALANYMKSFG
VLDNPVEYTLGVYFHHCAIAMSCRQLAMAGRFLAHNGQNPSTGLNVVSSERARRINALML
TCGHYDGSGEFAYRVGLPGKSGVGGGILAVAPGRASIAVWAPGLDAAGNSHLGRVALEGL
TKRMGWSIFGV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcagcttctcgaccgtgtcgttgccgaaatcgccgatgagatggcgcagcgg
gcggaccgcggcgaggtggcgagctatattccgcagctggcgcgggtcgatccgaaggcg
ttcggcctcgcggtgatcggcgccgacggtcatatcgcggccgccggcgatgccgatgtg
ccgttctcgatccagagcatctcgaaggtcttcacgctcacgctggcgctcggcaaggcc
ggcgaccggctgtggcgtcgcgtcgggcgagagccatccgggtccgccttcaactcgatc
gtgcagctcgagcacgagcgcggcatcccgcgcaatccgttcatcaatgccggtgcgatc
gccgtcaccgatctgatcctgtccgggcatcagccgcgcgaggcgctcggtgagattttg
cgcttcatgcagttcctcgccggcgattcctcgatcgccatcgatgaagcggtggcgaaa
tccgaacagcgcaccggatttcgcaacgctgcgctcgccaactacatgaagtcgttcggg
gtgctggacaatccggtcgagtacacgctcggcgtttatttccaccactgcgctatcgcg
atgagctgtcgccaactggcgatggccgggcgattcctggcgcacaacggccagaacccg
tcgaccggcctcaacgtggtgtcgagcgaacgggcacgtcgcatcaacgcgctgatgctg
acctgcggccattatgacggctcgggcgaattcgcctatcgggtcggcctgccgggcaag
agcggggtcggtggcggtatattggcggtcgcgccgggcagagcctcgatcgcggtgtgg
gcgccggggctcgatgccgcgggcaactcccatctcggccgcgttgcgctcgaggggctg
accaagcgcatgggctggtcgatcttcggcgtctga

DBGET integrated database retrieval system