KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4697Help
Entry
Rpal_4697         CDS       T00722                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpal_4697
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpal_4697
   00630 Glyoxylate and dicarboxylate metabolism
    Rpal_4697
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpal_4697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5055908..5058082
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGIAPDVFWAGLAAIVRDLAPKTRALLKTRDDLQ
AKIDAWHLANKGKKQDMAAYTAFLKEIGYLLPEPPTVPVETANIDEEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEATQAKGYDKARGDKVIAKAKAFLDQAAPLA
TGSHSDVTGYSVIAGQLSAKLKSGNATGLKKPAQFAGFRGDAANPSAVLLVNNGLHIEIK
IDRANTIGKDDPAGVADLVIESAVSTILDMEDSVAAVDADDKVLIYRNTLGLMDGTLSES
FEKGGKTVTRALNGDRTYTAPDGKEISLHGRSLLLMRNVGHHMWTDAVLDSDGQEIPEGF
LDAAVSGLIAIHDLKHLGKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVETMLGLTAN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLVDGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVIARQQELAKGGPRAKLEDILTIPVSNSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKDQVLDSLKRM
AVIVDKQNEGDALYRPIAPDFDGVAFEAACDLIFKGRAQPNGYTEYILHERRREAKAAHL
ESAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattgacgcccacggactgaaaatcgcgcctgtgctgttcgacttcatcgcc
aaggaggccgcgccgaaaaccggcatcgctcccgacgtattctgggccgggctcgctgcg
atcgttcgtgatctggcgccgaagacccgcgcgctgctgaagacccgcgacgacctgcag
gccaagatcgatgcgtggcatctcgccaacaagggcaagaagcaggacatggcggcctac
accgccttcctgaaggagatcggctacctgctgcccgagccgccgacggtgccggtcgag
accgccaatatcgacgaagagatcggcaagctgtgcggcccgcagctcgtggtgccgctg
tcgaatgcgcgctacgcactgaatgccgccaacgcgcgctggggttcgctgtacgacgca
ttctacggcaccgacgcgatcccgcaggaagccacccaggctaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcattcctcgaccaagccgcgccgctcgcg
accggcagccatagcgacgtcactggttacagcgtgatcgccggccagctgtcggccaag
ctgaagagcggcaatgccaccggcctgaagaaaccggcacagttcgccggcttccgcggc
gatgccgccaatccgagcgcggtgctgctggtcaacaacggcctgcacatcgagatcaag
atcgatcgcgccaacaccatcggcaaggacgatccggccggcgtcgccgacctggtcatc
gagtcggcggtctcgaccattctcgacatggaagactcggtcgccgccgtcgatgccgac
gacaaggtgctgatctatcgcaacaccctcggcctgatggacggcacgctgtcggaaagc
tttgagaagggcggcaagaccgttacccgcgcgctcaacggcgaccgcacctacaccgcg
ccggacggcaaggagatctcgctgcacggccgcagcctgctgctgatgcgcaacgtcggc
catcacatgtggaccgatgcggtgctcgacagcgacggccaggagattccggaaggcttc
ctcgacgctgcggtgtccggcctgatcgcgatccacgatctcaagcacctcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggatgaa
gtcgccctcaccgtcgagctgttcggccgcgtcgagaccatgctcggcctgaccgcgaac
accctgaaggtcggcatcatggacgaggaacgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtcgaagcggatcgtcttcatcaacaccggcttcctcgatcgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcctacgaagactggaacgtcgacaccggtttggtcgacggcctg
ccgggtcacgcccagatcggcaagggcatgtgggcggcccccgacaagatggccgacatg
ctggcgcagaagatcggtcacccgcaggccggcgcgaccaccgcctgggtgccgtcgccg
accgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgatcgcgcgccagcag
gagctggcgaagggcggtccgcgcgccaagctcgaagacatcctcaccatcccggtgtcg
aactcgaactgggcgccggacgatgtccgccaggagatcgacaacaactgccagggcatc
ctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggacatc
cacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcaagccagcacctcgcc
aactggctgcatcacggcgtcgtcaccaaggaccaggtgctcgactcgctgaagcggatg
gcggtgatcgtcgacaagcagaacgaaggcgatgcgctgtaccggccgattgcgccggac
ttcgacggcgtcgcgttcgaagccgcgtgcgacctgatcttcaagggccgcgcgcagccg
aacggctacaccgaatacatcctgcatgagcgccgccgcgaggccaaggcggcgcacctg
gagtcggcacgctaa

DBGET integrated database retrieval system