KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4878Help
Entry
Rpal_4878         CDS       T00722                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rpt01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rpt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5242479..5244113)
Genome map
AA seq 544 aa AA seqDB search
MNFQPRGISAIHAPTSYKSEIEAAEALLKDKPTWNGVTAEAVARMRLQNRFKTGLDIARY
TAAQMRADMAAYDADPTKYTQSLGCWHGFIAQQKLISIKKHGGGRTDRRYIYLSGWMIAA
LRSEFGPLPDQSMHEKTSVPALIEEIYTFLRQADSRELNDLFRQLDKAREARDKAKETAI
IDQIDNFQTHVVPIIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDG
KVTVPHDVFIAKVRAIRHAFLEMGVEDGIIVTRTDSLGAGLTQQIAVSHQPGDIGDQYNS
FLDCEEVDASKIGNGDVIISRNGKLLRPKRLPSNLYQFRPGTGADRCVLDCITSLQNGAD
LLWIETEKPHIEQIASMVDRIREVVPNAKLAYNNSPSFNWTLNFRWQVYDAWKEEGKDVS
KYNRAELMKAEYDETPLAIEADARIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAR
EYFGDQGMLGYVKNVQRQEIRQGIACVKHQNMAGSDIGDDHKEYFAGDAALKAGGEHNTM
NQFS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccagccacgcggcatcagcgccatccacgctccgacctcctacaagagcgag
atcgaagcggccgaagctctcctcaaggacaagccgacctggaatggcgtcaccgccgag
gccgtggctcggatgcgcctgcagaaccgcttcaagaccggtctggacatcgcccgttac
accgcggcccagatgcgcgccgacatggcggcgtatgacgccgacccgaccaagtacacc
cagtcgctgggctgctggcacggcttcatcgcgcagcagaagctgatctcgatcaagaag
cacggcggtggccgcaccgaccgtcgttacatctacctgtcgggctggatgatcgcggcg
ctgcgctcggagttcggtccgctgcccgaccagtcgatgcacgagaagacctcggtgccg
gcgctgatcgaagagatctacaccttcctgcgccaggcggattcgcgcgagctgaacgac
ctgttccgccagctcgacaaggcccgcgaggcccgcgacaaggccaaggaaaccgcgatc
atcgaccagatcgacaatttccagacccacgtcgtgccgatcatcgccgacatcgacgcc
ggcttcggtaacgccgaggcgacctatctgctcgccaagaagatgatcgaagcgggcgcc
tgcgcgctgcagatcgagaatcaggtctcggacgagaagcagtgcggccaccaggacggc
aaggtcaccgtgccgcacgacgtgttcatcgccaaggttcgcgcgatccgtcacgccttc
ctcgagatgggcgtggaagacggcatcatcgtcacccgcaccgactcgctcggagccggc
ctgacccagcagatcgccgtcagccatcagccgggtgacatcggcgaccagtacaacagc
ttcctggattgcgaggaagtcgatgccagcaagatcggcaacggcgacgtgatcatcagc
cgcaacggcaagctgctgcgtccgaagcgcctgccgagcaacctgtaccagttccgtccg
ggcaccggcgcggaccgctgcgtgctggactgcatcacctcgctgcagaacggcgccgac
ctgctgtggatcgaaaccgagaagccgcatatcgagcagatcgcctcgatggtcgatcgg
atccgcgaagtcgtgccgaacgccaagctggcctacaacaactcgccgtcgttcaactgg
acgctcaacttccgctggcaggtctatgacgcctggaaggaagagggcaaggacgtcagc
aagtacaaccgcgccgagctgatgaaggccgaatacgacgaaaccccgctggcgatcgaa
gccgacgcccgcatccgcaccttccaggcggattcggccaagcgcgccggcatcttccac
cacctgatcacgctgccgacctaccacacggctgcgctgtcgaccgacaacctggcccgc
gaatatttcggcgaccagggcatgctgggttatgttaagaacgtgcagcgccaggaaatc
cgtcagggcatcgcctgtgtgaagcaccagaacatggccggctcggacatcggcgacgat
cacaaggaatacttcgccggcgacgcggccctgaaggccggcggcgaacacaacacgatg
aaccagttcagctaa

DBGET integrated database retrieval system