KEGG   Rhodopseudomonas palustris TIE-1: Rpal_5127Help
Entry
Rpal_5127         CDS       T00722                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Rpal_5127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5513141..5513890
Genome map
AA seq 249 aa AA seqDB search
MSEAVMAGAEAFAFDGGKTGVLLVHGFTGSPQSMRYLGERLGERGYSIIGPRLPGHGVSP
AAMAKTTANDWVDCAEDALLELSAKCDKTFVAGLSMGGTLSLYLAASHPDKVAGVIPINA
AVQIDSPDLAGLAYARGLPEFVPGIGSDMVDTTTKELAYDQVPVTCVKQVMGLAATARAL
LPKIKCPTLVINSRVDHVLSPANATVIANHVGSSRIETLWLDNSYHVATIDNDKDLIASA
IDSFVTRNL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcggtgatggccggcgcggaggcgttcgcgttcgacggcggcaaaacgggc
gtgctgctggtgcatggatttaccggcagcccacagagcatgcgctatctcggagaacgg
ctcggcgagcgcggctattccattatcggccctcggctgcccggacacggcgtctcgccg
gccgcaatggccaagactaccgccaacgattgggtcgactgcgccgaggacgcgctgctg
gagctgtcggccaaatgcgacaaaaccttcgtggccggactgtcgatgggcggcacgctg
tcgctgtatctggccgcctcgcatccggacaaggtcgccggcgtgatcccgatcaacgct
gccgttcagatcgactcgcccgatctcgccgggctggcttacgcccgcggcctgccggaa
ttcgtccccggcatcggctcggacatggtcgacaccaccaccaaggagctggcctacgac
caggtgccggtgacctgcgtcaagcaggtgatgggactggccgccaccgcccgcgcgctg
ctgccgaagatcaagtgtccgaccttggtgatcaactcgcgcgtcgaccacgtgctgtcg
ccggccaatgcgaccgtgatcgccaaccacgtcggctccagccggatcgaaacgctgtgg
ctggacaattcctaccacgtcgccacgatcgacaacgacaaggacctgatcgcttctgcg
atcgacagtttcgtgacgcgcaacctgtga

DBGET integrated database retrieval system