KEGG   Rickettsia prowazekii RpGvF24: MA7_00615Help
Entry
MA7_00615         CDS       T01793                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpv  Rickettsia prowazekii RpGvF24
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA7_00615
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA7_00615
   00650 Butanoate metabolism
    MA7_00615
  Energy metabolism
   00190 Oxidative phosphorylation
    MA7_00615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150153..150530
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system