KEGG   Rickettsia prowazekii Chernikova: M9W_00610Help
Entry
M9W_00610         CDS       T01789                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:rpw01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rpw00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpw00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rpw00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
148132..148509
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system