KEGG   Rickettsia prowazekii Chernikova: M9W_01870Help
Entry
M9W_01870         CDS       T01789                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471079..471678
Genome map
AA seq 199 aa AA seqDB search
MIGKLNGKIDSHCDDYVIIDVNGVGYLVYASGKTLAKLVEGKFYKLFIETHVREEHIHLY
GFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIQIAINNDDRNIFKAISGVGAKLA
ERIMLELKDKITKIFSSSAIIKDSNISSIAINEVMKALVNLGFTRFEAQNTVQGIITQNP
KISIDELIKTALKNRNSSF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaaatggtaagattgattcacactgtgatgattatgtaataatcgat
gtaaacggggtaggttatcttgtgtatgcttcaggtaagaccttagcgaaacttgtggaa
ggtaagttttataaactattcatcgaaacccatgttagagaggaacatattcatctttac
ggttttctaactctagaagagaaaaatttttttaatttgctgcaatctgttaatggtatt
ggtacaaaaatggctttgtctatcttatcaaatcttactcctacggatattcagatcgct
ataaataatgatgatagaaatatatttaaagcaatatctggagttggtgctaagcttgct
gaacgtataatgctagaattgaaagataaaataacgaaaatatttagcagctctgctatt
attaaagatagtaacatttcatctattgcaattaatgaagtaatgaaagcattagtaaat
ctaggatttactcgatttgaagctcaaaacactgttcaaggcataattacccaaaatcct
aaaatctccattgatgaactaattaaaacagcattaaaaaatcgtaattctagtttttaa

DBGET integrated database retrieval system