KEGG   Rickettsia prowazekii Chernikova: M9W_02590Help
Entry
M9W_02590         CDS       T01789                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M9W_02590
Enzymes [BR:rpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     M9W_02590
Exosome [BR:rpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M9W_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665571..666563)
Genome map
AA seq 330 aa AA seqDB search
MYPLIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNEMQEIKTMPGIYRLSIDQI
VETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTIIKIKNANIDIGIICDV
ALDPYTISGHDGIVHHGEVDNDRSVKALCNQALVLAKAGVDIVAPSDMMDGRIAAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSYQIDVRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAETGAIDWERALIES
LISFKRAGATGIFTYAALEVAEILKHNNIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcttattagatttagaagaaatagaaaagctttatggcttagagagttaata
gcagagagtaatttatcgattagtgatttagtgttacctttatttgttgttgaaggccat
aatgaaatgcaagaaattaagactatgcctggtatatatcgtttatcgatcgatcagata
gttgaaactgcaaaaaaagcagcagattttggtattaatgcgattgcattatttcctagt
attgatcacagtctaaaaagtgacaatgcagatgaggcatataatttagataatttaata
tgtagaactattataaaaatcaaaaacgccaatattgacattggtataatatgtgatgta
gcacttgatccttacactataagtggccatgatggtattgttcatcatggagaagttgat
aatgataggtcagtaaaagctttatgtaatcaagcattagtattagcaaaagctggagta
gatatcgttgcaccttctgatatgatggatggaagaatagcagctatcagggagtatctt
gacaaagaaggctttataaatgtaggaattcttgcttatgcagctaaatatgcttcaagc
ttttatggcccatttcgcgatgcagttcagagtaataaaaagaattatttagataaatca
agctatcaaattgatgtgcgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagaaggagcagatattgtaatggttaaaccaggtatgccgtttttggatgtgattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggttagtggggaatacgca
atgttaaaatttgcagcagaaacaggggctattgattgggagagagcgttaatagaatca
ttaattagttttaaacgtgccggtgcaacaggaatatttacctatgctgctcttgaagta
gctgaaatattaaagcacaataacattaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system