KEGG   Rickettsia prowazekii Chernikova: M9W_04230Help
Entry
M9W_04230         CDS       T01789                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpw00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpw00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:rpw03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rpw03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1096119..1096583)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYHTSNELFLKAILRLIEKCYYSNFKSVILTTDVHQQEMLNKNLWTYSRKQFIPH
GSKFDPQPAKQPIYITDELQNPNNASVLVIISPTDIAKILQVKEYIKVFKRIIIITDLLE
NLKELIIKINKFTGQENKIDCFTQNPIGTWNKIA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcacacaagcaacgaattgtttctaaaagcaatattacgt
cttatagaaaaatgttattactctaattttaaaagtgtgatattaactacagatgtacat
caacaagaaatgctcaataaaaatctttggacttattcacgtaaacagtttatacctcat
ggtagtaaatttgatccgcagcctgcaaaacaacctatttatattacagatgagttacaa
aatcctaataatgctagtgttcttgttattatttcacctacagatatagcaaaaatttta
caagtcaaagaatatataaaagtcttcaaaaggataattataataacagatttactggaa
aatttaaaagaattaattattaaaataaataaatttactgggcaggaaaacaaaatagat
tgttttactcaaaatcctattggaacttggaataaaatagcataa

DBGET integrated database retrieval system