KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0071Help
Entry
Rpdx1_0071        CDS       T01381                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00260  Glycine, serine and threonine metabolism
rpx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01130  Biosynthesis of antibiotics
rpx01230  Biosynthesis of amino acids
Module
rpx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpdx1_0071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpdx1_0071
Enzymes [BR:rpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpdx1_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADU41715
JGI: Rpdx1_0071
UniProt: E6VF45
Position
74795..76009
Genome map
AA seq 404 aa AA seqDB search
MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEAKVDPAFRAEMDSHLK
HYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAE
TGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVREQIMQAEGRLPDSLIA
CIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASIAGGKPGVLHGNRTYLLMDA
DGQIEEAHSISAGLDYPGVGPEHSWLNDVGRVKFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEHLGGQF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctttgccgaattccttccggtccggccccgacgagcgcgggcatttcggc
atctatggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgatctggaaaag
gcctatgcggaagccaaggtcgacccggcattccgcgccgagatggacagccatctcaag
cactatgtcggacgtccctcggcgctgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgtgaagacctcaaccacaccggcgcccacaaggtgaac
aacgtgctcggccagatcatgctggccaagcgcatgggcaagccgcgggtgatcgcagag
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgccaagttcggtctcgaa
tgcgtggtgttcatgggggcggtcgacgtcgaacgccagcagcccaacgtgctgcggatg
aaggcgctcggtgccgaagtccgccccgtcacctccggcgccaatacgctgaaggacgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacgacaccttctactgcatcggc
accgtggccggtccgcacccctatccgatgatggtgcgcgacttccaggcggtgatcggc
caggaagtccgcgagcagatcatgcaggccgaaggccgcctcccggactcgctgatcgcc
tgcatcggcggcggctccaacgcgatgggcctgttccatccgttcctggacgatccgggc
gtcgcgatctacggcgtcgaagccgcaggccacggcctcgacaagctgcatgcggcctcg
atcgccggtggcaagccgggcgtgctgcacggcaaccgcacctacctgttgatggatgcg
gacggccagatcgaggaagcgcattcgatctccgccggcctcgactatccgggcgtcggc
ccggagcattcctggctgaacgacgtcggacgggtcaaattcctgtccgccaccgacacc
gaagcgctcgacgccttcaagctgtgctgtcgactggaaggaatcatcccggcgctggag
ccgagccacgcgctcgccaaggtcgcggacctcgcgccgaagctgccgaaggatcacctg
atggtcgtcaacatgtccggccgcggcgacaaggatctcgcctcggtcgccgaacatctc
gggggccaattctaa

DBGET integrated database retrieval system