KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0211Help
Entry
Rpdx1_0211        CDS       T01381                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rpdx1_0211
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_0211
  Lipid metabolism
   00071 Fatty acid degradation
    Rpdx1_0211
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpdx1_0211
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpdx1_0211
   00626 Naphthalene degradation
    Rpdx1_0211
Enzymes [BR:rpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpdx1_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(237575..238558)
Genome map
AA seq 327 aa AA seqDB search
MDAMVLTAPGTPLQWQQRDTPHPGDGEVLVTVSACGVCRTDLHVVDGELPNIRYPIIPGH
EIVGRVAAIGGGVTTHRIGDRVGIPWLGHTCGVCRYCRSGMENLCDAPLFTGYTRDGGFA
SHAIADARYAFPLGEADDDVAIAPLLCAGLIGWRSLVIAGPAERLGIYGFGAAGHIVAQV
ARWQGRQVYAFTRGGDVAAQEFARSLGAVWAGASEELPPEPLDAAIIYAPVGSLVPAALK
AVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQDGIDFLAVAARAGIRTETH
AFPLREANAVLTKLRAGELLGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatggtgctgacggcgccgggcacgccgctgcagtggcagcagcgcgacacc
ccgcacccgggcgacggcgaagtgctggtgacggtgagcgcctgcggcgtctgccgcacc
gatctgcacgtcgtcgacggcgaactgcccaacatccgctatccgatcatcccgggccac
gagatcgtcggccgcgtcgcagcgatcggcggcggcgtcacgacccaccgcatcggcgac
cgcgtcgggattccctggctcggccacacctgcggggtgtgccgctactgccgcagcggc
atggaaaatctgtgcgacgcgccgctgttcaccggctacactcgcgacggcggcttcgcg
agccacgccatcgccgacgcgcgctacgcgtttccgcttggcgaggccgacgatgacgtt
gcgattgcgccgctgctgtgcgccggactgatcggctggcgctcgctggtgatcgccgga
ccggcggagcggctcggcatctacggcttcggcgccgccgggcacatcgtggcacaggtg
gcgcgctggcagggtcggcaggtttacgctttcacccgcggcggcgacgtcgccgcgcag
gagttcgcccgcagcttaggggcggtatgggccggcgcgtcggaagagctgccgcccgag
ccgctcgacgccgcgatcatctacgcgccggtcggcagcctggtgccggccgcgttgaag
gcggtgcgcaaaggcggccgcgtggtctgcgccggcattcatatgagcgacatcccgagc
tttccgtacgatctgctttgggaggaacgccagctcgtctcggtcgccaatctgacgcgg
caggacggcatcgattttctcgccgtcgcggcgcgggccgggatcaggaccgagacccac
gcgtttccgctgcgtgaggccaacgcggttctgaccaagctccgcgccggcgaactgctc
ggtgcagcggtgctggtgccgtag

DBGET integrated database retrieval system