KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0215Help
Entry
Rpdx1_0215        CDS       T01381                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rpx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rpx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(241020..242300)
Genome map
AA seq 426 aa AA seqDB search
MPRTTKIVFLGASSASFGLSMFRDLFASPVLAGSTLTLVGRNPATLGRMTELAKLLNARS
GAGLVIEHTTDRRAALDGAGFVINATAIDRNRLWKQDFEVPKKHGIRHTLGENGGPGGLF
FTLRTLPLVFDFIRDIEELCPNALFLNYSNPESRIILALGRYTKVRHIGLCHGIFMGRDA
IAYIMQMPREEIEVWGAGLNHFQCLMQIRHRDTGEDLYPRFRAAEQSFDPDAWRFTRRLY
RAFGYWLTCSDDHLGEYLPYGWEAGENGYDFDQDERWRGEFLNQLDGVLGGTMPIPQWWT
EPSGERGAAVIAAMLHDQKRFIESGIVLNRGVIPNLPAELAVEVPVTVDAAGVHPVSLGP
LPDPIAKLMLMQASVQQLAVEAAVHASKELALQALLIDPVINSAVAAEKLLDELWEINRP
YIRKCV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaccaccaagatcgtcttcctcggcgcttccagtgcgtcgttcggtctcagc
atgtttcgtgacctgttcgcatcgccggtgctggccggttcgacgctgacgctggtcgga
cgcaatcccgcaacgctcggccgaatgacggagctggcaaaactcctgaatgcgcgatcc
ggcgccggactggtgatcgaacacaccaccgaccgccgcgccgcgctggatggcgccggc
ttcgtcatcaacgccactgcgatcgatcgcaaccggctctggaagcaggatttcgaggtg
ccgaagaagcacggcatccgtcacaccctcggcgagaacggtggccccggcggattgttc
ttcacgctgcgcacgctgccgctggtgttcgacttcatccgcgacatcgaggagctgtgc
cccaacgcgctgttcctcaactactccaatccggagagccggatcattctggcgctcggc
cgctacaccaaggtgcgccacatcgggctgtgccacggcatcttcatgggccgcgacgcg
atcgcctacatcatgcagatgccacgcgaagagatcgaagtctggggcgccgggctcaat
cacttccagtgcctgatgcagatccgccatcgcgacaccggcgaggacctgtatccgcgg
tttcgcgccgccgagcagagcttcgatccggatgcctggcggttcacgcggcggctgtat
cgcgccttcggctactggctgacctgcagcgacgatcatctcggcgagtatctgccatac
ggctgggaagccggcgagaacggctacgatttcgaccaggacgaacgctggcgcggcgaa
tttctaaatcagctcgacggcgtgctgggcggcaccatgccgatcccgcaatggtggacc
gagccgtccggcgaacgcggcgcggcggtgatcgccgcgatgctgcacgaccagaagcgc
ttcatcgaatccggcatcgtgctcaatcgcggcgtgatccccaacctgccggcggagctc
gccgtcgaagtcccggtgacggtggacgcggccggcgtgcacccggtgtcgctcggcccg
ctgcccgacccgatcgccaagctgatgctgatgcaggccagcgtccagcaactcgccgtc
gaagccgcagtgcacgcgtccaaagagctggcgctgcaggcgctgctgatcgatccggtg
atcaactcggcggtcgccgccgagaagctcctcgacgagctgtgggagatcaatcggccc
tacattcgaaagtgtgtgtag

DBGET integrated database retrieval system