KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0216Help
Entry
Rpdx1_0216        CDS       T01381                                 

Definition
1-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpdx1_0216
   01230 Biosynthesis of amino acids
    Rpdx1_0216
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_0216
   00030 Pentose phosphate pathway
    Rpdx1_0216
   00051 Fructose and mannose metabolism
    Rpdx1_0216
   00052 Galactose metabolism
    Rpdx1_0216
  Energy metabolism
   00680 Methane metabolism
    Rpdx1_0216
Enzymes [BR:rpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rpdx1_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
242542..243480
Genome map
AA seq 312 aa AA seqDB search
MADIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVARVVRRFGGDVEAIFP
AGGFTGKLLKLLLDEESVPSRIVEAVAETREDFSVSENATGEQYRFVLPGLPLAEHEWRG
MLDTLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQLGAKFFLDTSGKPLTAALAQG
VTLIKPNLREMQELAGRPLGCEKEWVDAARAHISAGQVEIVALSLGHLGALLVTKDQALR
SPALPVTPVSTVGAGDSFLGAIAYRLAQGGSIADAFRLGLAAGSATLTVHGTQLCGPDEV
ERLYAQVIIEPI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcgtcaccctcacgcccaatcctgcgatcgacctgtcgacgtcggtcgag
cgtctggtgccgagccgcaagctgcgctgcgccgcgcaaaagcgcgatcccggcgggggc
ggcatcaacgtcgcgcgggtggtgaggcggttcggcggtgacgtcgaggcgatcttcccg
gccggcggcttcaccggcaagctgctcaagctgctgctcgacgaggagagcgtcccgagc
cgcatcgtcgaagcggtggcggagacgcgcgaggatttctcggtcagcgaaaacgccacc
ggcgaacaataccgcttcgtgctgcccggcctgccgctcgccgagcacgaatggcgcggc
atgctcgacaccttggcggcgacctcgccggcgccgaagatcgtgatcggcagcggcagc
ctgccgccgggcgtcccggtcgatttctacgcgcaggccgccgcggtggcgaagcagctc
ggcgccaaattcttcctcgacacgtccggcaagccgctgaccgcggcgcttgcccagggc
gtcacgctgatcaagccgaacctgcgcgagatgcaggaactcgccggccgcccgctgggc
tgcgagaaggaatgggtcgacgccgcgcgggcgcatatcagcgccggtcaggtcgagatc
gtggcactgtcgctcggccatctcggcgcgctgctggtcaccaaggaccaggcactgcga
tcgccggcactgccggtgaccccggtgtcgacggtcggggccggtgacagtttcctcggc
gcgattgcgtatcggctggcccaaggcggctcgattgcggatgcgttccggctcggcctt
gcggcaggctcggccactctgacggtccacggcacgcaattgtgcggcccggatgaggtc
gagcggctttacgcccaggtgatcatcgagccgatctga

DBGET integrated database retrieval system