KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0443Help
Entry
Rpdx1_0443        CDS       T01381                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rpdx1_0443
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rpdx1_0443
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rpdx1_0443
Lipid biosynthesis proteins [BR:rpx01004]
 Fatty acid synthase
  Component type
   Rpdx1_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
479195..479812
Genome map
AA seq 205 aa AA seqDB search
MAALIPGQGAQAEATIKPLKVVVLGDSLTAGYGLPAADAFPAKLQKALKAKGIETEMVNA
GVSGDTASGGLARLDWSVPPDADAVIVELGANDALRGTDPKVPRKALDEILKRLQQRKMP
VLLAGMLAPPNYGKDYAAQFNAIYPELAATYDVPLYPFFLDGVAAVSNLNQPDGIHPTAA
GVDVIVERILPMVEALLRPLLGQRS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgatcccgggccagggtgcgcaagcggaagcgaccatcaagccgctgaag
gtggtggtgctcggcgattccctgaccgcaggctacggtctgccggccgccgacgcgttt
ccggccaagctgcaaaaagcgttgaaggccaaaggcatcgagaccgagatggtgaatgcg
ggggtgtcgggcgataccgccagtggcgggctcgcgcggctcgattggtcggtgccgccc
gatgccgatgcggtgatcgtcgagctcggcgccaacgatgcgctgcgcggcaccgatccc
aaggtcccgcgcaaggcgctcgacgagattttgaagcggctgcaacagcgcaagatgccg
gtgctgctcgccggcatgctggcgccgccgaattacggcaaggactatgctgcgcagttc
aacgcgatttatccggagctcgccgcgacatacgacgtgccgctgtatccgtttttcctc
gacggcgtcgcggcagtttcgaacctcaaccagcccgacggtattcaccccaccgccgca
ggggtcgacgtcatcgtcgaacgcattctgcccatggtggaggcgttgctccgcccgctc
ctcgggcagcgaagctga

DBGET integrated database retrieval system