KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0447Help
Entry
Rpdx1_0447        CDS       T01381                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpdx1_0447
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpdx1_0447
   00640 Propanoate metabolism
    Rpdx1_0447
   00660 C5-Branched dibasic acid metabolism
    Rpdx1_0447
Enzymes [BR:rpx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rpdx1_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
483038..484234
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGVAVGHGFPIFKASEAEAAAKQLGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSIDEVKDYAKQMLGATLVTVQTGADGKQVNRLYIEEGSDIDKEFYL
SLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPATGIMGHHGRTVAKALNLK
GDQAKQAEAMVAKLYAAFVAKDMDMLEINPLVLTKQGDLKCLDAKISFDGNALYRHIDIQ
ALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMATMDIIKLYGMAPANFLDVG
GGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAEGVVAAVKEVGLDVPLVVRLE
GTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaaggcggtgttgcgcgagttcggcgtggcggtgggt
cacggcttcccgatcttcaaggcgtccgaggcggaagccgctgccaagcagctcggcggt
ccggtctgggtggtgaagagccagatccacgctggcggtcgcggcaagggcaagttcaag
gaagcctcggccggtgacaagggcggcgtccgcctcgccaagtcgatcgacgaggtcaag
gactacgccaagcagatgctcggcgccacgctggtgacggtgcagaccggagccgacggc
aagcaggtcaatcgcctgtacatcgaggaaggctccgacatcgacaaggaattctacctg
tcgctgctggtcgatcgcgccacctcgcggatttctttcgtggtctcgaccgagggcggc
atgtcgatcgaggacgtcgcccacgagacgcctgaaaagatcgtgtcgttcaccgtcgat
ccggcgaccggcatcatgggtcatcacggccgcaccgtcgccaaggcgctcaacctgaag
ggcgatcaggccaagcaggccgaggcgatggtggccaagctgtacgccgcgttcgtcgcc
aaagacatggacatgctcgagatcaacccgctggtgctgaccaagcagggcgatctgaag
tgtctcgacgccaagatctcgttcgacggcaacgcgctgtaccgccacatcgacatccag
gcgctgcgcgacgagaccgaggaagacgccaaggagatcgaggcgtcgaaatacgacctc
aattacgtcaccctcgacggcaccatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgatggacatcatcaagctgtacggcatggccccggccaacttcctcgacgtcggc
ggcggcgccagcaaggagaaggtgacggcggcgttcaagatcatcaccgccgatccgaac
gtgaagggcatcctgatcaacatcttcggcggcatcatgaagtgcgacgtgatcgccgag
ggcgtggtcgcggcggtcaaggaagtcggtctcgacgtgccgctggtggttcgcctcgaa
ggcaccaatgtcgaagccggcaagaagatcatcaagcattccggcctcaacgtgctgccc
gccgacaatctcgacgacgccgcgcagaagatcgtcgccgccgtgaagggagcctga

DBGET integrated database retrieval system