KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0450Help
Entry
Rpdx1_0450        CDS       T01381                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpdx1_0450
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpdx1_0450
  Amino acid metabolism
   00310 Lysine degradation
    Rpdx1_0450
Enzymes [BR:rpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rpdx1_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
488368..489609
Genome map
AA seq 413 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKQPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVAVGALLGQITDGAAPAKPAAAAPAKAAPAPAAQAPAPAAPAAKTPPSDAPLAPS
VRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRAPSPADD
AAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFEKKHGAKL
GFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGTDKGLVVPVVRDCDTKSI
AEIETSISDFGRRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKIQ
ERPVVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccgacgctcggcgaatcggtgaccgaggcgaccatcggccgc
tggttcaagcagccgggcgaggcggtggcggtcgacgaaccgctcgtcgagctcgagacc
gacaaggtgaccatcgaggtgccggctccatcggccggcacgctgggcgagatcgtcgcc
aaggatggcgagaccgtcgctgtcggcgcgctgctcggccagatcaccgatggcgccgcc
ccggccaagccggctgccgccgctcccgccaaggccgcgccggcgcccgccgcgcaggct
ccggcgcccgctgcgcccgccgccaagaccccgccgtcagatgcgccgctggcgccgtcg
gtgcgccggctgtcgaccgaaagcggcgtcgacgcatcgaccgtgccgggctcgggcaag
gacggccgcgtcaccaagggcgacatgctggcggcgatcgagaaggcggcgtctgcgccg
accccggtcaatcagcccgcggccgccgtacaggtccgggcgccgtcgccggccgacgac
gccgcgcgcgaagagcgggtcaagatgacccggctgcgccagaccatcgcgcgccgcctg
aaggaagtgcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgaccaac
gtcatggcgctgcgcgcgcagtacaaggacgtgttcgaaaagaagcacggcgccaagctc
ggcttcatgggattcttcaccaaggcctgcgtccaggccctgaaggacatcccggccgtc
aacgccgagatcgacggcaccgacctgatctacaagaactactatcacgtcggcgtcgcg
gtcggcaccgacaagggtctggttgtgccggtggtgcgcgactgcgacaccaagtcgatc
gccgaaatcgaaacttcgatctccgacttcggccggcgcgcccgtgacggtcagctcaag
atcgaagagatgcagggcggcaccttcaccatcaccaacggcggcatctacggctcgctg
atgtcgaccccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaagatccag
gaacgcccggtggtggtcggcggcaagatcgaggtgcggccgatgatgtatctggcgctg
agctacgaccaccgcgtgatcgacggcaaggaagcggtgaccttcctggtccgtgtcaag
gaaagcctggaagatccggcccggctggtgctggatctctga

DBGET integrated database retrieval system